Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-App AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)

Rabbit App Polyclonal Antibody | anti-APP antibody

App antibody - C-terminal region

Gene Names
App; Ag; Abpp; Adap; Cvap; Abeta; betaApp; E030013M08Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
App; Polyclonal Antibody; App antibody - C-terminal region; anti-APP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQ
Sequence Length
751
Applicable Applications for anti-APP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human App
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-App AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)

Western Blot (WB) (WB Suggested Anti-App AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)
Related Product Information for anti-APP antibody
This is a rabbit polyclonal antibody against App. It was validated on Western Blot

Target Description: App functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. It is involved in cell mobility and transcription regulation through protein-protein interactions.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
amyloid-beta A4 protein isoform 3
NCBI Official Synonym Full Names
amyloid beta (A4) precursor protein
NCBI Official Symbol
App
NCBI Official Synonym Symbols
Ag; Abpp; Adap; Cvap; Abeta; betaApp; E030013M08Rik
NCBI Protein Information
amyloid-beta A4 protein; amyloid beta A4 protein
UniProt Protein Name
Amyloid beta A4 protein
Protein Family
UniProt Gene Name
App
UniProt Synonym Gene Names
APP; AG; S-APP-alpha; S-APP-beta; AID(59); AID(57); AID(50)
UniProt Entry Name
A4_MOUSE

Uniprot Description

APP: a cell surface receptor that influences neurite growth, neuronal adhesion and axonogenesis. Cleaved by secretases to form a number of peptides, some of which bind to the acetyltransferase complex Fe65/TIP60 to promote transcriptional activation. The Abeta peptide is released from the cell, its extracellular deposition and accumulation form the main components of amyloid plaques in Alzheimer's disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis. Can promote transcription activation through binding to Fe65-Tip60 and inhibits Notch signaling through interaction with Numb. Couples to apoptosis-inducing pathways such as those mediated by G(O) and JIP. Inhibits G(O) alpha ATPase activity. Acts as a kinesin I membrane receptor, mediating the axonal transport of beta-secretase and presenilin 1. Involved in copper homeostasis/oxidative stress through copper ion reduction. In vitro, copper-metallated APP induces neuronal death directly or is potentiated through Cu(2+)-mediated low-density lipoprotein oxidation. Can regulate neurite outgrowth through binding to components of the extracellular matrix such as heparin and collagen I and IV. Induces a RAGE-dependent pathway that activates p38 MAPK, resulting in internalization of amyloid-beta peptide and leading to mitochondrial dysfunction in cultured cortical neurons. Provides Cu(2+) ions for GPC1 which are required for release of nitric oxide (NO) and subsequent degradation of the heparan sulfate chains on GPC1. Binds, via its C-terminus, to the PID domain of several cytoplasmic proteins, including APBB family members, the APBA family, JIP1, SHC1 and, NUMB and DAB1. Binding to DAB1 inhibits its serine phosphorylation. Associates with microtubules in the presence of ATP and in a kinesin-dependent manner. Amyloid beta-42 binds nAChRA7 in hippocampal neurons. Beta-amyloid associates with HADH2. Soluble APP binds, via its N-terminal head, to FBLN1. Expressed in all fetal tissues examined with highest levels in brain, kidney, heart and spleen. Weak expression in liver. In adult brain, highest expression found in the frontal lobe of the cortex and in the anterior perisylvian cortex- opercular gyri. Moderate expression in the cerebellar cortex, the posterior perisylvian cortex-opercular gyri and the temporal associated cortex. Weak expression found in the striate, extra- striate and motor cortices. Expressed in cerebrospinal fluid, and plasma. 10 isoforms of the human protein are produced by alternative splicing. Isoform APP695 is the predominant form in neuronal tissue, isoform APP751 and isoform APP770 are widely expressed in non- neuronal cells. Isoform APP751 is the most abundant form in T-lymphocytes. Appican is expressed in astrocytes. The splice isoforms that contain the BPTI domain possess protease inhibitor activity. Belongs to the APP family.

Protein type: Membrane protein, integral; Transcription factor; Cell surface; Receptor, misc.; Apoptosis

Cellular Component: apical part of cell; axon; cell surface; ciliary rootlet; coated pit; cytoplasm; cytoplasmic vesicle; endosome; ER to Golgi transport vesicle; extracellular space; Golgi apparatus; growth cone; integral to membrane; intercellular junction; intracellular membrane-bound organelle; lipid raft; membrane; neuromuscular junction; neuron projection; nuclear envelope lumen; perinuclear region of cytoplasm; plasma membrane; receptor complex; rough endoplasmic reticulum; spindle midzone; terminal button

Molecular Function: acetylcholine receptor binding; DNA binding; enzyme binding; heparin binding; identical protein binding; metal ion binding; protease activator activity; protease inhibitor activity; protein binding; PTB domain binding; receptor binding; serine-type endopeptidase inhibitor activity; transition metal ion binding

Biological Process: adult locomotory behavior; antibacterial humoral response; antifungal humoral response; apoptosis; axon cargo transport; axon midline choice point recognition; axonogenesis; cell adhesion; cellular copper ion homeostasis; cholesterol metabolic process; collateral sprouting in the absence of injury; defense response to Gram-negative bacterium; defense response to Gram-positive bacterium; dendrite development; endocytosis; extracellular matrix organization and biogenesis; forebrain development; innate immune response; ionotropic glutamate receptor signaling pathway; locomotory behavior; mating behavior; mRNA polyadenylation; negative regulation of neuron differentiation; negative regulation of peptidase activity; nervous system development; neurite development; neuromuscular process controlling balance; neuron apoptosis; neuron remodeling; Notch signaling pathway; positive regulation of mitotic cell cycle; positive regulation of transcription from RNA polymerase II promoter; protein amino acid phosphorylation; protein homooligomerization; regulation of epidermal growth factor receptor activity; regulation of gene expression; regulation of multicellular organism growth; regulation of protein binding; regulation of synapse structure and activity; regulation of translation; response to oxidative stress; response to yeast; smooth endoplasmic reticulum calcium ion homeostasis; suckling behavior; synaptic growth at neuromuscular junction; visual learning

Research Articles on APP

Similar Products

Product Notes

The APP app (Catalog #AAA3214078) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The App antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's App can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APP app for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVMLKKKQYT SIHHGVVEVD AAVTPEERHL SKMQQNGYEN PTYKFFEQMQ. It is sometimes possible for the material contained within the vial of "App, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.