Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: APOMSample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human APOM Polyclonal Antibody | anti-APOM antibody

APOM Antibody - middle region

Gene Names
APOM; G3a; NG20; apo-M; HSPC336
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
APOM; Polyclonal Antibody; APOM Antibody - middle region; anti-APOM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSL
Sequence Length
188
Applicable Applications for anti-APOM antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human APOM
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: APOMSample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: APOMSample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-APOM antibody
The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Alternate splicing results in both coding and non-coding variants of this gene.
Product Categories/Family for anti-APOM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20 kDa
NCBI Official Full Name
apolipoprotein M isoform 2
NCBI Official Synonym Full Names
apolipoprotein M
NCBI Official Symbol
APOM
NCBI Official Synonym Symbols
G3a; NG20; apo-M; HSPC336
NCBI Protein Information
apolipoprotein M
UniProt Protein Name
Apolipoprotein M
Protein Family
UniProt Gene Name
APOM
UniProt Synonym Gene Names
G3A; NG20; Apo-M; ApoM
UniProt Entry Name
APOM_HUMAN

NCBI Description

The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Alternate splicing results in both coding and non-coding variants of this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

APOM: Probably involved in lipid transport. Can bind sphingosine-1-phosphate, myristic acid, palmitic acid and stearic acid, retinol, all-trans-retinoic acid and 9-cis-retinoic acid. Plasma protein. Expressed in liver and kidney. Belongs to the calycin superfamily. Lipocalin family. Highly divergent.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 6p21.33

Cellular Component: integral to plasma membrane

Molecular Function: lipid transporter activity; antioxidant activity; phospholipid binding

Biological Process: cholesterol homeostasis; reverse cholesterol transport; response to glucose stimulus; cholesterol efflux; lipoprotein metabolic process

Research Articles on APOM

Similar Products

Product Notes

The APOM apom (Catalog #AAA3222368) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOM Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APOM apom for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GRPDMKTELF SSSCPGGIML NETGQGYQRF LLYNRSPHPP EKCVEEFKSL. It is sometimes possible for the material contained within the vial of "APOM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.