Western Blot (WB)
(WB Suggested Anti-APOL3 AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Rabbit anti-Human APOL3 Polyclonal Antibody | anti-APOL3 antibody
APOL3 Antibody - middle region
Gene Names
APOL3; CG121; CG12_1; APOLIII; apoL-III
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
APOL3; Polyclonal Antibody; APOL3 Antibody - middle region; anti-APOL3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGC
Sequence Length
402
Applicable Applications for anti-APOL3 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human APOL3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-APOL3 AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-APOL3 AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Related Product Information for anti-APOL3 antibody
This is a rabbit polyclonal antibody against APOL3. It was validated on Western Blot
Target Description: This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 6. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants.
Target Description: This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 6. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-APOL3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
apolipoprotein L3 isoform 1
NCBI Official Synonym Full Names
apolipoprotein L3
NCBI Official Symbol
APOL3
NCBI Official Synonym Symbols
CG121; CG12_1; APOLIII; apoL-III
NCBI Protein Information
apolipoprotein L3
UniProt Protein Name
Apolipoprotein L3
Protein Family
UniProt Gene Name
APOL3
UniProt Entry Name
APOL3_HUMAN
NCBI Description
This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 22. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]
Research Articles on APOL3
Similar Products
Product Notes
The APOL3 apol3 (Catalog #AAA3217217) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOL3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APOL3 apol3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AIEDEYVQQK DEQFREWFLK EFPQVKRKIQ ESIEKLRALA NGIEEVHRGC. It is sometimes possible for the material contained within the vial of "APOL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
