Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: APODSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human APOD Polyclonal Antibody | anti-APOD antibody

APOD Antibody - middle region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
APOD; Polyclonal Antibody; APOD Antibody - middle region; anti-APOD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRA
Sequence Length
189
Applicable Applications for anti-APOD antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human APOD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: APODSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: APODSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-APOD antibody
This gene encodes a component of high density lipoprotein that has no marked similarity to other apolipoprotein sequences. It has a high degree of homology to plasma retinol-binding protein and other members of the alpha 2 microglobulin protein superfamily of carrier proteins, also known as lipocalins. This glycoprotein is closely associated with the enzyme lecithin:cholesterol acyltransferase - an enzyme involved in lipoprotein metabolism.
Product Categories/Family for anti-APOD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
347
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21 kDa
NCBI Official Full Name
apolipoprotein D
NCBI Official Synonym Full Names
apolipoprotein D
NCBI Official Symbol
APOD
NCBI Protein Information
apolipoprotein D
UniProt Protein Name
Apolipoprotein D
Protein Family
UniProt Gene Name
APOD
UniProt Synonym Gene Names
Apo-D; ApoD
UniProt Entry Name
APOD_HUMAN

NCBI Description

This gene encodes a component of high density lipoprotein that has no marked similarity to other apolipoprotein sequences. It has a high degree of homology to plasma retinol-binding protein and other members of the alpha 2 microglobulin protein superfamily of carrier proteins, also known as lipocalins. This glycoprotein is closely associated with the enzyme lecithin:cholesterol acyltransferase - an enzyme involved in lipoprotein metabolism. [provided by RefSeq, Aug 2008]

Uniprot Description

APOD: APOD occurs in the macromolecular complex with lecithin- cholesterol acyltransferase. It is probably involved in the transport and binding of bilin. Appears to be able to transport a variety of ligands in a number of different contexts. Belongs to the calycin superfamily. Lipocalin family.

Protein type: Secreted; Lipid-binding; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 3q29

Cellular Component: extracellular space; cell soma; endoplasmic reticulum; perinuclear region of cytoplasm; dendrite; extracellular region

Molecular Function: lipid transporter activity; protein binding; cholesterol binding

Biological Process: response to drug; negative regulation of smooth muscle cell proliferation; negative regulation of focal adhesion formation; glucose metabolic process; negative regulation of protein import into nucleus; lipid transport; axon regeneration in the peripheral nervous system; response to reactive oxygen species; tissue regeneration; response to axon injury; brain development; lipid metabolic process; angiogenesis; aging

Research Articles on APOD

Similar Products

Product Notes

The APOD apod (Catalog #AAA3221225) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOD Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APOD apod for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QENFDVNKYL GRWYEIEKIP TTFENGRCIQ ANYSLMENGK IKVLNQELRA. It is sometimes possible for the material contained within the vial of "APOD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.