Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Rat APOC4 Polyclonal Antibody | anti-APOC4 antibody

APOC4 (Apolipoprotein C-IV, Apo-CIV, ApoC-IV, Apolipoprotein C4) (MaxLight 550)

Gene Names
APOC4; APO-CIV; APOC-IV
Reactivity
Human, Rat
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
APOC4; Polyclonal Antibody; APOC4 (Apolipoprotein C-IV; Apo-CIV; ApoC-IV; Apolipoprotein C4) (MaxLight 550); anti-APOC4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human APOC4. Species Crossreactivity: rat
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-APOC4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length protein corresponding to aa1-127 from human APOC4 (NP_001637.1)
Immunogen Sequence
MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
Conjugate
MaxLight550
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-APOC4 antibody
Apolipoprotein C4 is a member of the apolipoprotein family. The gene encoding APOC4 is expressed in the liver and has a predicted protein structure characteristic of the other genes in this family.
Product Categories/Family for anti-APOC4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
346
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,553 Da
NCBI Official Full Name
apolipoprotein C-IV
NCBI Official Synonym Full Names
apolipoprotein C-IV
NCBI Official Symbol
APOC4
NCBI Official Synonym Symbols
APO-CIV; APOC-IV
NCBI Protein Information
apolipoprotein C-IV; apolipoprotein C4
UniProt Protein Name
Apolipoprotein C-IV
Protein Family
UniProt Gene Name
APOC4
UniProt Synonym Gene Names
Apo-CIV; ApoC-IV
UniProt Entry Name
APOC4_HUMAN

NCBI Description

This gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is thought to play a role in lipid metabolism. Polymorphisms in this gene may influence circulating lipid levels and may be associated with coronary artery disease risk. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring downstream apolipoprotein C-II (APOC2) gene. [provided by RefSeq, Mar 2011]

Uniprot Description

APOC4: May participate in lipoprotein metabolism. Belongs to the apolipoprotein C4 family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 19q13.2

Molecular Function: lipid transporter activity

Biological Process: lipid metabolic process; lipid transport

Research Articles on APOC4

Similar Products

Product Notes

The APOC4 apoc4 (Catalog #AAA6370096) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOC4 (Apolipoprotein C-IV, Apo-CIV, ApoC-IV, Apolipoprotein C4) (MaxLight 550) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's APOC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the APOC4 apoc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APOC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.