Western Blot (WB)
(WB Suggested Anti-APOBEC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Rabbit APOBEC4 Polyclonal Antibody | anti-APOBEC4 antibody
APOBEC4 antibody - N-terminal region
Gene Names
APOBEC4; C1orf169
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
APOBEC4; Polyclonal Antibody; APOBEC4 antibody - N-terminal region; anti-APOBEC4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIIL
Sequence Length
367
Applicable Applications for anti-APOBEC4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Pig: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-APOBEC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Western Blot (WB)
(WB Suggested Anti-APOBEC4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Related Product Information for anti-APOBEC4 antibody
This is a rabbit polyclonal antibody against APOBEC4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: APOBEC4 is a putative C to U editing enzyme whose physiological substrate is not yet known.This gene encodes a member of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases, which convert cytidine to uridine. Other AID/APOBEC family members are involved in mRNA editing, somatic hypermutation and recombination of immunoglobulin genes, and innate immunity to retroviral infection.
Target Description: APOBEC4 is a putative C to U editing enzyme whose physiological substrate is not yet known.This gene encodes a member of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases, which convert cytidine to uridine. Other AID/APOBEC family members are involved in mRNA editing, somatic hypermutation and recombination of immunoglobulin genes, and innate immunity to retroviral infection.
Product Categories/Family for anti-APOBEC4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
putative C->U-editing enzyme APOBEC-4
NCBI Official Synonym Full Names
apolipoprotein B mRNA editing enzyme catalytic polypeptide like 4
NCBI Official Symbol
APOBEC4
NCBI Official Synonym Symbols
C1orf169
NCBI Protein Information
putative C->U-editing enzyme APOBEC-4
UniProt Protein Name
Putative C->U-editing enzyme APOBEC-4
Protein Family
UniProt Gene Name
APOBEC4
UniProt Synonym Gene Names
C1orf169
UniProt Entry Name
ABEC4_HUMAN
NCBI Description
This gene encodes a member of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases, which convert cytidine to uridine. Other AID/APOBEC family members are involved in mRNA editing, somatic hypermutation and recombination of immunoglobulin genes, and innate immunity to retroviral infection. [provided by RefSeq, Jul 2008]
Uniprot Description
APOBEC4: Putative C to U editing enzyme whose physiological substrate is not yet known. Belongs to the cytidine and deoxycytidylate deaminase family.
Protein type: EC 3.5.4.-; Hydrolase
Chromosomal Location of Human Ortholog: 1q25.3
Molecular Function: zinc ion binding; hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
Biological Process: mRNA processing
Research Articles on APOBEC4
Similar Products
Product Notes
The APOBEC4 apobec4 (Catalog #AAA3212501) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOBEC4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's APOBEC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APOBEC4 apobec4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LKTSSGSLVQ KGHASSCTGN YIHPESMLFE MNGYLDSAIY NNDSIRHIIL. It is sometimes possible for the material contained within the vial of "APOBEC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
