Western Blot (WB)
(Host: RabbitTarget Name: bK150C2.9Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit APOBEC3D Polyclonal Antibody | anti-APOBEC3D antibody
APOBEC3D Antibody - C-terminal region
Gene Names
APOBEC3D; A3D; ARP6; APOBEC3E; APOBEC3DE
Reactivity
Cow, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
APOBEC3D; Polyclonal Antibody; APOBEC3D Antibody - C-terminal region; anti-APOBEC3D antibody
Host
Rabbit
Reactivity
Cow, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVK
Sequence Length
202
Applicable Applications for anti-APOBEC3D antibody
Western Blot (WB)
Homology
Cow: 77%; Human: 100%; Pig: 77%; Rabbit: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human APOBEC3D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: bK150C2.9Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: bK150C2.9Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-APOBEC3D antibody
This is a rabbit polyclonal antibody against bK150C2.9. It was validated on Western Blot
Target Description: This gene is a member of the cytidine deaminase gene family. It is one of a group of related genes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.
Target Description: This gene is a member of the cytidine deaminase gene family. It is one of a group of related genes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.
Product Categories/Family for anti-APOBEC3D antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22kDa
NCBI Official Full Name
Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D
NCBI Official Synonym Full Names
apolipoprotein B mRNA editing enzyme catalytic subunit 3D
NCBI Official Symbol
APOBEC3D
NCBI Official Synonym Symbols
A3D; ARP6; APOBEC3E; APOBEC3DE
NCBI Protein Information
DNA dC->dU-editing enzyme APOBEC-3D
UniProt Protein Name
BK150C2.9 protein
Protein Family
UniProt Gene Name
bK150C2.9
UniProt Synonym Gene Names
APOBEC3D
UniProt Entry Name
Q6ICH2_HUMAN
NCBI Description
This gene is a member of the cytidine deaminase gene family. It is one of a group of related genes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA. [provided by RefSeq, Jul 2008]
Research Articles on APOBEC3D
Similar Products
Product Notes
The APOBEC3D bk150c2.9 (Catalog #AAA3201999) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOBEC3D Antibody - C-terminal region reacts with Cow, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's APOBEC3D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APOBEC3D bk150c2.9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CPECAGEVAE FLARHSNVNL TIFTARLCYF WDTDYQEGLC SLSQEGASVK. It is sometimes possible for the material contained within the vial of "APOBEC3D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
