Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: APOA5Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human APOA5 Polyclonal Antibody | anti-APOA5 antibody

APOA5 Antibody - middle region

Gene Names
APOA5; RAP3; APOAV
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
APOA5; Polyclonal Antibody; APOA5 Antibody - middle region; anti-APOA5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AHELVGWNLEGLRQQLKPYTMDLMEQVALRVQELQEQLRVVGEDTKAQLL
Sequence Length
366
Applicable Applications for anti-APOA5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human APOA5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: APOA5Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: APOA5Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-APOA5 antibody
The protein encoded by this gene is an apolipoprotein that plays an important role in regulating the plasma triglyceride levels, a major risk factor for coronary artery disease. It is a component of high density lipoprotein and is highly similar to a rat protein that is upregulated in response to liver injury. Mutations in this gene have been associated with hypertriglyceridemia and hyperlipoproteinemia type 5. This gene is located proximal to the apolipoprotein gene cluster on chromosome 11q23. Alternatively spliced transcript variants encoding the same protein have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
apolipoprotein A-V
NCBI Official Synonym Full Names
apolipoprotein A5
NCBI Official Symbol
APOA5
NCBI Official Synonym Symbols
RAP3; APOAV
NCBI Protein Information
apolipoprotein A-V
UniProt Protein Name
Apolipoprotein A-V
Protein Family
UniProt Gene Name
APOA5
UniProt Synonym Gene Names
RAP3; Apo-AV; ApoA-V
UniProt Entry Name
APOA5_HUMAN

NCBI Description

The protein encoded by this gene is an apolipoprotein that plays an important role in regulating the plasma triglyceride levels, a major risk factor for coronary artery disease. It is a component of high density lipoprotein and is highly similar to a rat protein that is upregulated in response to liver injury. Mutations in this gene have been associated with hypertriglyceridemia and hyperlipoproteinemia type 5. This gene is located proximal to the apolipoprotein gene cluster on chromosome 11q23. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Oct 2009]

Uniprot Description

APOA5: Minor apolipoprotein mainly associated with HDL and to a lesser extent with VLDL. May also be associated with chylomicrons. Important determinant of plasma triglyceride (TG) levels by both being a potent stimulator of apo-CII lipoprotein lipase (LPL) TG hydrolysis and a inhibitor of the hepatic VLDL-TG production rate (without affecting the VLDL-apoB production rate). Activates poorly lecithin:cholesterol acyltransferase (LCAT) and does not enhance efflux of cholesterol from macrophages. Interacts with GPIHBP1. Up-regulated by PPARA agonists, which are used clinically to lower serum TG (such as fibrates). Liver and plasma. Belongs to the apolipoprotein A1/A4/E family.

Protein type: Lipid-binding; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11q23

Cellular Component: extracellular space; chylomicron; extracellular region

Molecular Function: heparin binding; enzyme binding; low-density lipoprotein receptor binding; cholesterol transporter activity; enzyme activator activity; cholesterol binding; phospholipid binding; phosphatidylcholine binding; lipid binding

Biological Process: positive regulation of fatty acid biosynthetic process; organ regeneration; response to hormone stimulus; neurite regeneration; lipoprotein metabolic process; positive regulation of lipid catabolic process; cholesterol efflux; cellular lipid metabolic process; lipid transport; cholesterol biosynthetic process; positive regulation of receptor-mediated endocytosis; phosphatidylcholine metabolic process; cholesterol homeostasis; reverse cholesterol transport; triacylglycerol metabolic process; phospholipid efflux; regulation of cholesterol absorption; tissue regeneration; acylglycerol homeostasis; triacylglycerol catabolic process; positive regulation of lipoprotein lipase activity

Disease: Hypertriglyceridemia, Familial; Hyperlipoproteinemia, Type V

Research Articles on APOA5

Similar Products

Product Notes

The APOA5 apoa5 (Catalog #AAA3221138) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOA5 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOA5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APOA5 apoa5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AHELVGWNLE GLRQQLKPYT MDLMEQVALR VQELQEQLRV VGEDTKAQLL. It is sometimes possible for the material contained within the vial of "APOA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.