Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: APIPSample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit APIP Polyclonal Antibody | anti-APIP antibody

APIP Antibody - N-terminal region

Gene Names
APIP; APIP2; CGI29; hAPIP; CGI-29; MMRP19
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
APIP; Polyclonal Antibody; APIP Antibody - N-terminal region; anti-APIP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AARSDEIYIAPSGVQKERIQPEDMFVCDINEKDISGPSPSKKLKKSQCTP
Sequence Length
204
Applicable Applications for anti-APIP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human APIP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: APIPSample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: APIPSample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-APIP antibody
This is a rabbit polyclonal antibody against APIP. It was validated on Western Blot

Target Description: APIP is an APAF1-interacting protein that acts as a negative regulator of ischemic/hypoxic injury.
Product Categories/Family for anti-APIP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
Methylthioribulose-1-phosphate dehydratase
NCBI Official Synonym Full Names
APAF1 interacting protein
NCBI Official Symbol
APIP
NCBI Official Synonym Symbols
APIP2; CGI29; hAPIP; CGI-29; MMRP19
NCBI Protein Information
methylthioribulose-1-phosphate dehydratase
UniProt Protein Name
Methylthioribulose-1-phosphate dehydratase
UniProt Gene Name
APIP
UniProt Entry Name
MTNB_HUMAN

NCBI Description

APIP is an APAF1 (MIM 602233)-interacting protein that acts as a negative regulator of ischemic/hypoxic injury (Cho et al., 2004 [PubMed 15262985]).[supplied by OMIM, Dec 2008]

Uniprot Description

MMRP19: Catalyzes the dehydration of methylthioribulose-1- phosphate (MTRu-1-P) into 2,3-diketo-5-methylthiopentyl-1- phosphate (DK-MTP-1-P). Has an anti-apoptotic function and prevents muscle ischemic damage. Inhibits the cytochrome c- dependent and APAF1-mediated cell death. Belongs to the aldolase class II family. MtnB subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 4.2.1.109; Amino Acid Metabolism - cysteine and methionine; Apoptosis

Chromosomal Location of Human Ortholog: 11p13

Cellular Component: cytoplasm

Molecular Function: identical protein binding; 5-methylthioribulose-1-phosphate 4-dehydratase activity; protein binding; zinc ion binding

Biological Process: methionine salvage; sulfur amino acid metabolic process; apoptosis; methionine biosynthetic process from S-adenosylmethionine; polyamine metabolic process; negative regulation of apoptosis

Research Articles on APIP

Similar Products

Product Notes

The APIP apip (Catalog #AAA3213001) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APIP Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's APIP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APIP apip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AARSDEIYIA PSGVQKERIQ PEDMFVCDIN EKDISGPSPS KKLKKSQCTP. It is sometimes possible for the material contained within the vial of "APIP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.