Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of AP4M1 expression in transfected 293T cell line by AP4M1 polyclonal antibody. Lane 1: AP4M1 transfected lysate (49.83kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human AP4M1 Polyclonal Antibody | anti-AP4M1 antibody

AP4M1 (MUARP2, AP-4 Complex Subunit mu-1, AP-4 Adapter Complex mu Subunit, Adapter-related Protein Complex 4 mu-1 Subunit, Mu Subunit of AP-4, Mu-adaptin-related Protein 2, Mu4-adaptin)

Gene Names
AP4M1; MU-4; CPSQ3; SPG50; MU-ARP2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
AP4M1; Polyclonal Antibody; AP4M1 (MUARP2; AP-4 Complex Subunit mu-1; AP-4 Adapter Complex mu Subunit; Adapter-related Protein Complex 4 mu-1 Subunit; Mu Subunit of AP-4; Mu-adaptin-related Protein 2; Mu4-adaptin); Anti -AP4M1 (MUARP2; anti-AP4M1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human AP4M1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGDESPVVMHHHGRHFIHIRHSGLYLVVTTSENVSPFSLLELLSRLATLLGDYCGSLGEGTISRNVALVYELLDEVLDYGYVQTTSTEMLRNFIQTEAVVSKPFSLFDLSSVGLFGAETQQSKVAPSSAASRPVLSSRSDQSQKNEVFLDVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFESHRILRLQPPQGELTVMRYQLSDDLPSPLPFRLFPSVQWDRGSGRLQVYLKLRCDLLSKSQALNVRLHLPLPRGVVSLSQELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQVRFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI
Applicable Applications for anti-AP4M1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human AP4M1, aa1-453 (NP_004713.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of AP4M1 expression in transfected 293T cell line by AP4M1 polyclonal antibody. Lane 1: AP4M1 transfected lysate (49.83kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AP4M1 expression in transfected 293T cell line by AP4M1 polyclonal antibody. Lane 1: AP4M1 transfected lysate (49.83kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-AP4M1 antibody
This gene encodes a subunit of the heterotetrameric AP-4 complex. The encoded protein belongs to the adaptor complexes medium subunits family. This AP-4 complex is involved in the recognition and sorting of cargo proteins with tyrosine-based motifs from the trans-golgi network to the endosomal-lysosomal system.
Product Categories/Family for anti-AP4M1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,977 Da
NCBI Official Full Name
AP-4 complex subunit mu-1
NCBI Official Synonym Full Names
adaptor-related protein complex 4, mu 1 subunit
NCBI Official Symbol
AP4M1
NCBI Official Synonym Symbols
MU-4; CPSQ3; SPG50; MU-ARP2
NCBI Protein Information
AP-4 complex subunit mu-1; mu4; mu4-adaptin; mu subunit of AP-4; mu-adaptin-related protein 2; mu-adaptin-related protein-2; adapter-related protein complex 4 mu-1 subunit; adaptor-related protein complex AP-4 mu4 subunit
UniProt Protein Name
AP-4 complex subunit mu-1
Protein Family
UniProt Gene Name
AP4M1
UniProt Synonym Gene Names
MUARP2; mu-ARP2; mu4
UniProt Entry Name
AP4M1_HUMAN

NCBI Description

This gene encodes a subunit of the heterotetrameric AP-4 complex. The encoded protein belongs to the adaptor complexes medium subunits family. This AP-4 complex is involved in the recognition and sorting of cargo proteins with tyrosine-based motifs from the trans-golgi network to the endosomal-lysosomal system. [provided by RefSeq, Jul 2008]

Uniprot Description

AP4M1: Subunit of novel type of clathrin- or non-clathrin- associated protein coat involved in targeting proteins from the trans-Golgi network (TGN) to the endosomal-lysosomal system. Defects in AP4M1 are the cause of cerebral palsy spastic quadriplegic type 3 (CPSQ3). A non-progressive disorder of movement and/or posture resulting from defects in the developing central nervous system. Affected individuals present postnatally with early infantile hypotonia, delayed psychomotor development, strabismus, lack of independent walking and severe mental retardation. They develop progressive spasticity of all limbs with generalized hypertonia, hyperreflexia, and extensor plantar responses by the end of the first year of life. Speech is absent or limited. Pseudobulbar signs, such as drooling, stereotypic laughter, and exaggerated jaw jerk, are part of the clinical picture. Belongs to the adaptor complexes medium subunit family.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: clathrin adaptor complex; Golgi trans cisterna; AP-type membrane coat adaptor complex; coated pit; trans-Golgi network

Molecular Function: transporter activity

Biological Process: vesicle-mediated transport; intracellular protein transport; Golgi to endosome transport

Disease: Spastic Paraplegia 50, Autosomal Recessive

Research Articles on AP4M1

Similar Products

Product Notes

The AP4M1 ap4m1 (Catalog #AAA6012395) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AP4M1 (MUARP2, AP-4 Complex Subunit mu-1, AP-4 Adapter Complex mu Subunit, Adapter-related Protein Complex 4 mu-1 Subunit, Mu Subunit of AP-4, Mu-adaptin-related Protein 2, Mu4-adaptin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AP4M1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the AP4M1 ap4m1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MISQFFILSS KGDPLIYKDF RGDSGGRDVA ELFYRKLTGL PGDESPVVMH HHGRHFIHIR HSGLYLVVTT SENVSPFSLL ELLSRLATLL GDYCGSLGEG TISRNVALVY ELLDEVLDYG YVQTTSTEML RNFIQTEAVV SKPFSLFDLS SVGLFGAETQ QSKVAPSSAA SRPVLSSRSD QSQKNEVFLD VVERLSVLIA SNGSLLKVDV QGEIRLKSFL PSGSEMRIGL TEEFCVGKSE LRGYGPGIRV DEVSFHSSVN LDEFESHRIL RLQPPQGELT VMRYQLSDDL PSPLPFRLFP SVQWDRGSGR LQVYLKLRCD LLSKSQALNV RLHLPLPRGV VSLSQELSSP EQKAELAEGA LRWDLPRVQG GSQLSGLFQM DVPGPPGPPS HGLSTSASPL GLGPASLSFE LPRHTCSGLQ VRFLRLAFRP CGNANPHKWV RHLSHSDAYV IRI. It is sometimes possible for the material contained within the vial of "AP4M1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.