Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ANXA6 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateANXA6 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit ANXA6 Polyclonal Antibody | anti-ANXA6 antibody

ANXA6 antibody - N-terminal region

Gene Names
ANXA6; p68; p70; ANX6; CBP68; CPB-II
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
ANXA6; Polyclonal Antibody; ANXA6 antibody - N-terminal region; anti-ANXA6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYE
Sequence Length
673
Applicable Applications for anti-ANXA6 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 85%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 85%; Rat: 93%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ANXA6 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateANXA6 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-ANXA6 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateANXA6 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-ANXA6 antibody
This is a rabbit polyclonal antibody against ANXA6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Exon 21 of annexin VI is alternatively spliced, giving rise to two isoforms that differ by a 6-amino acid insertion at the start of the seventh repeat. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis.
Product Categories/Family for anti-ANXA6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
309
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
annexin A6 isoform 1
NCBI Official Synonym Full Names
annexin A6
NCBI Official Symbol
ANXA6
NCBI Official Synonym Symbols
p68; p70; ANX6; CBP68; CPB-II
NCBI Protein Information
annexin A6
UniProt Protein Name
Annexin A6
Protein Family
UniProt Gene Name
ANXA6
UniProt Synonym Gene Names
ANX6; CPB-II
UniProt Entry Name
ANXA6_HUMAN

NCBI Description

Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2010]

Uniprot Description

ANXA6: a calcium/phospholipid-binding protein that may associate with CD21. May regulate the release of Ca(2+) from intracellular stores. Phosphorylated in response to growth factor stimulation. Annexins are a family of structurally related proteins whose common property is calcium-dependent binding to phospholipids. There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1, A2 and A5) appear to be secreted in a physiologically regulated fashion.

Protein type: Motility/polarity/chemotaxis; Calcium-binding; Lipid-binding

Chromosomal Location of Human Ortholog: 5q33.1

Cellular Component: focal adhesion; membrane; lysosomal membrane; late endosome membrane; perinuclear region of cytoplasm; melanosome

Molecular Function: protein binding; protein homodimerization activity; GTP binding; calcium-dependent phospholipid binding; cholesterol binding; calcium ion binding; lipid binding; calcium-dependent protein binding; ligand-gated ion channel activity

Biological Process: regulation of muscle contraction; calcium ion transport; protein homooligomerization

Research Articles on ANXA6

Similar Products

Product Notes

The ANXA6 anxa6 (Catalog #AAA3203200) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANXA6 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ANXA6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ANXA6 anxa6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALYTAMKGFG SDKEAILDII TSRSNRQRQE VCQSYKSLYG KDLIADLKYE. It is sometimes possible for the material contained within the vial of "ANXA6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.