Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: ANXA2Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

Rabbit anti-Human ANXA2 Polyclonal Antibody | anti-ANXA2 antibody

ANXA2 Antibody - N-terminal region

Gene Names
ANXA2; P36; ANX2; LIP2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV; HEL-S-270
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ANXA2; Polyclonal Antibody; ANXA2 Antibody - N-terminal region; anti-ANXA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETV
Sequence Length
339
Applicable Applications for anti-ANXA2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANXA2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: ANXA2Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: ANXA2Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ANXA2Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ANXA2Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ANXA2 antibody
This is a rabbit polyclonal antibody against ANXA2. It was validated on Western Blot

Target Description: This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
302
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
annexin A2 isoform 2
NCBI Official Synonym Full Names
annexin A2
NCBI Official Symbol
ANXA2
NCBI Official Synonym Symbols
P36; ANX2; LIP2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV; HEL-S-270
NCBI Protein Information
annexin A2
UniProt Protein Name
Annexin A2
Protein Family
UniProt Gene Name
ANXA2
UniProt Synonym Gene Names
ANX2; ANX2L4; CAL1H; LPC2D; PAP-IV
UniProt Entry Name
ANXA2_HUMAN

NCBI Description

This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ANXA2: a calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. Heterotetramer containing 2 light chains of S100A10 2 heavy chains of ANXA2. May cross-link plasma membrane phospholipids with actin and the cytoskeleton and be involved with exocytosis. Annexins are a family of structurally related proteins whose common property is calcium-dependent binding to phospholipids. There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1, A2 and A5) appear to be secreted in a physiologically regulated fashion.

Protein type: Motility/polarity/chemotaxis; Lipid-binding; Calcium-binding

Chromosomal Location of Human Ortholog: 15q22.2

Cellular Component: extrinsic to plasma membrane; extracellular space; protein complex; cell surface; lysosomal membrane; late endosome membrane; early endosome; lipid particle; cell cortex; lipid raft; extracellular matrix; ruffle; membrane; perinuclear region of cytoplasm; melanosome; plasma membrane; basement membrane; midbody; nucleus; sarcolemma; endosome; vesicle

Molecular Function: phosphatidylinositol-4,5-bisphosphate binding; protein binding; calcium-dependent phospholipid binding; phospholipase A2 inhibitor activity; cytoskeletal protein binding; calcium ion binding; calcium-dependent protein binding; Rab GTPase binding

Biological Process: positive regulation of fibroblast proliferation; fibrinolysis; collagen fibril organization; negative regulation of catalytic activity; protein heterotetramerization; positive regulation of vesicle fusion; angiogenesis; positive regulation of binding; positive regulation of protein amino acid phosphorylation; lipid raft formation; body fluid secretion; membrane budding

Research Articles on ANXA2

Similar Products

Product Notes

The ANXA2 anxa2 (Catalog #AAA3220172) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANXA2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANXA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ANXA2 anxa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KGVDEVTIVN ILTNRSNAQR QDIAFAYQRR TKKELASALK SALSGHLETV. It is sometimes possible for the material contained within the vial of "ANXA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.