Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ANT1/ANT2/ANT3/ANT4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 150s.)

Rabbit ANT1/ANT2/ANT3/ANT4 Polyclonal Antibody | anti-ANT1/ANT2/ANT3/ANT4 antibody

ANT1/ANT2/ANT3/ANT4 Rabbit pAb

Gene Names
SLC25A4; 1; T1; ANT; AAC1; ANT1; PEO2; PEO3; ANT 1; MTDPS12
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purification
Synonyms
ANT1/ANT2/ANT3/ANT4; Polyclonal Antibody; ANT1/ANT2/ANT3/ANT4 Rabbit pAb; anti-ANT1/ANT2/ANT3/ANT4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
GMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
Applicable Applications for anti-ANT1/ANT2/ANT3/ANT4 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ANT1 (NP_001142.2).
Positive Samples
Mouse brain, Mouse skeletal muscle, Rat heart
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using ANT1/ANT2/ANT3/ANT4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 150s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ANT1/ANT2/ANT3/ANT4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 150s.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded Mouse kidney using ANT1/ANT2/ANT3/ANT4 Rabbit pAb at dilution of 1:50 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded Mouse kidney using ANT1/ANT2/ANT3/ANT4 Rabbit pAb at dilution of 1:50 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded Rat kidney using ANT1/ANT2/ANT3/ANT4 Rabbit pAb at dilution of 1:50 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded Rat kidney using ANT1/ANT2/ANT3/ANT4 Rabbit pAb at dilution of 1:50 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded Human colon carcinoma using ANT1/ANT2/ANT3/ANT4 Rabbit pAb at dilution of 1:50 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded Human colon carcinoma using ANT1/ANT2/ANT3/ANT4 Rabbit pAb at dilution of 1:50 (40x lens).)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
291
UniProt Accession #
Molecular Weight
298
NCBI Official Full Name
ADP/ATP translocase 1
NCBI Official Synonym Full Names
solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4
NCBI Official Symbol
SLC25A4
NCBI Official Synonym Symbols
1; T1; ANT; AAC1; ANT1; PEO2; PEO3; ANT 1; MTDPS12
NCBI Protein Information
ADP/ATP translocase 1; ADP,ATP carrier protein 1; solute carrier family 25 member 4; heart/skeletal muscle ATP/ADP translocator; ADP,ATP carrier protein, heart/skeletal muscle; adenine nucleotide translocator 1 (skeletal muscle)
UniProt Protein Name
ADP/ATP translocase 1
UniProt Gene Name
SLC25A4
UniProt Synonym Gene Names
ANT1; ANT 1
UniProt Entry Name
ADT1_HUMAN

NCBI Description

This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy. [provided by RefSeq, Jun 2013]

Uniprot Description

SLC25A4: Catalyzes the exchange of cytoplasmic ADP with mitochondrial ATP across the mitochondrial inner membrane. Defects in SLC25A4 are a cause of progressive external ophthalmoplegia with mitochondrial DNA deletions autosomal dominant type 2 (PEOA2). Progressive external ophthalmoplegia is characterized by progressive weakness of ocular muscles and levator muscle of the upper eyelid. In a minority of cases, it is associated with skeletal myopathy, which predominantly involves axial or proximal muscles and which causes abnormal fatigability and even permanent muscle weakness. Ragged- red fibers and atrophy are found on muscle biopsy. A large proportion of chronic ophthalmoplegias are associated with other symptoms, leading to a multisystemic pattern of this disease. Additional symptoms are variable, and may include cataracts, hearing loss, sensory axonal neuropathy, ataxia, depression, hypogonadism, and parkinsonism. Belongs to the mitochondrial carrier family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Transporter; Transporter, SLC family; Mitochondrial

Chromosomal Location of Human Ortholog: 4q35

Cellular Component: mitochondrion; integral to plasma membrane; mitochondrial inner membrane; nucleus

Molecular Function: protein binding; adenine transmembrane transporter activity

Biological Process: adenine transport; mitochondrial genome maintenance; apoptotic mitochondrial changes; generation of precursor metabolites and energy; viral reproduction; transport; energy reserve metabolic process; regulation of insulin secretion; transmembrane transport

Disease: Mitochondrial Dna Depletion Syndrome 12 (cardiomyopathic Type); Progressive External Ophthalmoplegia With Mitochondrial Dna Deletions, Autosomal Dominant, 2

Research Articles on ANT1/ANT2/ANT3/ANT4

Similar Products

Product Notes

The ANT1/ANT2/ANT3/ANT4 slc25a4 (Catalog #AAA9142139) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANT1/ANT2/ANT3/ANT4 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ANT1/ANT2/ANT3/ANT4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:50-1:200. Researchers should empirically determine the suitability of the ANT1/ANT2/ANT3/ANT4 slc25a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GMLPDPKNVH IFVSWMIAQS VTAVAGLVSY PFDTVRRRMM MQSGRKGADI MYTGTVDCWR KIAKDEGAKA FFKGAWSNVL RGMGGAFVLV LYDEIKKYV. It is sometimes possible for the material contained within the vial of "ANT1/ANT2/ANT3/ANT4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.