Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ANPEP AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit ANPEP Polyclonal Antibody | anti-ANPEP antibody

ANPEP antibody - N-terminal region

Gene Names
ANPEP; APN; CD13; LAP1; P150; PEPN; GP150
Reactivity
Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ANPEP; Polyclonal Antibody; ANPEP antibody - N-terminal region; anti-ANPEP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA
Sequence Length
967
Applicable Applications for anti-ANPEP antibody
Western Blot (WB)
Homology
Dog: 79%; Guinea Pig: 85%; Horse: 86%; Human: 100%; Rabbit: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ANPEP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ANPEP AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-ANPEP AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-ANPEP antibody
This is a rabbit polyclonal antibody against ANPEP. It was validated on Western Blot

Target Description: Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. Human aminopeptidase N is a receptor for one strain of human coronavirus that is an important cause of upper respiratory tract infections. Defects in this gene appear to be a cause of various types of leukemia or lymphoma.
Product Categories/Family for anti-ANPEP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
290
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
106kDa
NCBI Official Full Name
aminopeptidase N
NCBI Official Synonym Full Names
alanyl aminopeptidase, membrane
NCBI Official Symbol
ANPEP
NCBI Official Synonym Symbols
APN; CD13; LAP1; P150; PEPN; GP150
NCBI Protein Information
aminopeptidase N
UniProt Protein Name
Aminopeptidase N
Protein Family
UniProt Gene Name
ANPEP
UniProt Synonym Gene Names
APN; CD13; PEPN; AP-N; hAPN; AP-M
UniProt Entry Name
AMPN_HUMAN

NCBI Description

Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. Human aminopeptidase N is a receptor for one strain of human coronavirus that is an important cause of upper respiratory tract infections. Defects in this gene appear to be a cause of various types of leukemia or lymphoma. [provided by RefSeq, Jul 2008]

Uniprot Description

CD13: Broad specificity aminopeptidase. Plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. May play a critical role in the pathogenesis of cholesterol gallstone disease. May be involved in the metabolism of regulatory peptides of diverse cell types including small intestinal and tubular epithelial cells, macrophages, granulocytes and synaptic membranes from the CNS. Found to cleave antigen peptides bound to major histocompatibility complex class II molecules of presenting cells and to degrade neurotransmitters at synaptic junctions. Is also implicated as a regulator of IL-8 bioavailability in the endometrium, and therefore may contribute to the regulation of angiogenesis. Is used as a marker for acute myeloid leukemia and plays a role in tumor invasion. In case of human coronavirus 229E (HCoV-229E) infection, serves as receptor for HCoV-229E spike glycoprotein. Mediates as well human cytomegalovirus (HCMV) infection. Belongs to the peptidase M1 family.

Protein type: Receptor, misc.; EC 3.4.11.2; Other Amino Acids Metabolism - glutathione; Membrane protein, integral; Protease

Chromosomal Location of Human Ortholog: 15q25-q26

Cellular Component: extracellular space; lysosomal membrane; integral to plasma membrane; ER-Golgi intermediate compartment; cytosol; external side of plasma membrane

Molecular Function: viral receptor activity; zinc ion binding; metallopeptidase activity; receptor activity; aminopeptidase activity

Biological Process: entry of virus into host cell; cellular protein metabolic process; angiogenesis; angiotensin maturation; cell differentiation; proteolysis

Research Articles on ANPEP

Similar Products

Product Notes

The ANPEP anpep (Catalog #AAA3215065) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANPEP antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ANPEP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ANPEP anpep for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VGGSQPPDID KTELVEPTEY LVVHLKGSLV KDSQYEMDSE FEGELADDLA. It is sometimes possible for the material contained within the vial of "ANPEP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.