Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ANLN expression in transfected 293T cell line by ANLN polyclonal antibody. Lane 1: ANLN transfected lysate (44.55kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human ANLN Polyclonal Antibody | anti-ANLN antibody

ANLN (Actin-binding Protein Anillin, DKFZp779A055, Scraps, Scra)

Gene Names
ANLN; scra; Scraps
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ANLN; Polyclonal Antibody; ANLN (Actin-binding Protein Anillin; DKFZp779A055; Scraps; Scra); Anti -ANLN (Actin-binding Protein Anillin; anti-ANLN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ANLN.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MQELNNEINMQQTVIYQASQALNCCVDEEHGKGSLEEAEAERLLLIATGKRTLLIDELNKLKNEGPQRKNKASPQSEFMPSKGSVTLSEIRLPLKADFVCSTVQKPDAANYYYLIILKAGAENMVATPLASTSNSLNGDALTFTTTFTLQDVSNDFEINIEVYSLVQKKDPSGLDKKKKTSKSKAITPKRLLTSITTKSNIHSSVMASPGGLSAVRTSNFALVGSYTLSLSSVGNTKFVLDKVPFLSSLEGHIYLKIKCQVNSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYPDDEKRKNPIGRINLANCTSRQIEPANREFCARRNTFELITVRPQREDDRETLVSQCRDTLCVTKNWLSADTKEERDLWMQKLNQVLVDIRLWQPDACYKPIGKP
Applicable Applications for anti-ANLN antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human ANLN, aa-405 (AAH34692.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ANLN expression in transfected 293T cell line by ANLN polyclonal antibody. Lane 1: ANLN transfected lysate (44.55kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ANLN expression in transfected 293T cell line by ANLN polyclonal antibody. Lane 1: ANLN transfected lysate (44.55kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to ANLN on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to ANLN on HeLa cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-ANLN antibody
Anillin is an actin-binding protein that can bind septins and is a component of the cytokinetic ring. Anillin is expressed ubiquitously but with variable levels of expression, being highest in the central nervous system. Anillin is overexpressed in diverse common human tumors, but not simply as a consequence of being a proliferation marker. Anillin may have potential as a novel biomarker.
Product Categories/Family for anti-ANLN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
124,199 Da
NCBI Official Full Name
actin-binding protein anillin isoform 3
NCBI Official Synonym Full Names
anillin, actin binding protein
NCBI Official Symbol
ANLN
NCBI Official Synonym Symbols
scra; Scraps
NCBI Protein Information
actin-binding protein anillin
UniProt Protein Name
Actin-binding protein anillin
Protein Family
UniProt Gene Name
ANLN
UniProt Entry Name
ANLN_HUMAN

NCBI Description

This gene encodes an actin-binding protein that plays a role in cell growth and migration, and in cytokinesis. The encoded protein is thought to regulate actin cytoskeletal dynamics in podocytes, components of the glomerulus. Mutations in this gene are associated with focal segmental glomerulosclerosis 8. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]

Uniprot Description

anillin: an actin binding protein that interacts with cleavage furrow proteins such as septins and may play a role in cytokinesis.

Protein type: Motility/polarity/chemotaxis; Actin-binding

Chromosomal Location of Human Ortholog: 7p15-p14

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; contractile ring; actin cytoskeleton

Molecular Function: actin binding

Biological Process: mitosis; cytokinesis after mitosis; regulation of exit from mitosis; septin ring assembly; hemopoietic progenitor cell differentiation

Disease: Focal Segmental Glomerulosclerosis 8

Research Articles on ANLN

Similar Products

Product Notes

The ANLN anln (Catalog #AAA6013325) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ANLN (Actin-binding Protein Anillin, DKFZp779A055, Scraps, Scra) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANLN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the ANLN anln for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQELNNEINM QQTVIYQASQ ALNCCVDEEH GKGSLEEAEA ERLLLIATGK RTLLIDELNK LKNEGPQRKN KASPQSEFMP SKGSVTLSEI RLPLKADFVC STVQKPDAAN YYYLIILKAG AENMVATPLA STSNSLNGDA LTFTTTFTLQ DVSNDFEINI EVYSLVQKKD PSGLDKKKKT SKSKAITPKR LLTSITTKSN IHSSVMASPG GLSAVRTSNF ALVGSYTLSL SSVGNTKFVL DKVPFLSSLE GHIYLKIKCQ VNSSVEERGF LTIFEDVSGF GAWHRRWCVL SGNCISYWTY PDDEKRKNPI GRINLANCTS RQIEPANREF CARRNTFELI TVRPQREDDR ETLVSQCRDT LCVTKNWLSA DTKEERDLWM QKLNQVLVDI RLWQPDACYK PIGKP. It is sometimes possible for the material contained within the vial of "ANLN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.