Rabbit ANGPTL2 Polyclonal Antibody | anti-ANGPTL2 antibody

Anti-ANGPTL2 Antibody

Cat. Num. AAA178696

• Gene Names: ANGPTL2; ARP2; HARP
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen affinity purified.
• Synonyms: ANGPTL2; Polyclonal Antibody; Anti-ANGPTL2 Antibody; AI593246; Angptl2; Arp2; HARP; MGC8889; UNQ170/PRO196; Q9UKU9; Angiopoietin-related protein 2; angiopoietin like 2; anti-ANGPTL2 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 493

• Applicable Applications for anti-ANGPTL2 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: WB: 0.1-0.5ug/ml; Tested Species: Mouse, Rat; Predicted Species: Human; IHC-Paraffin: 0.5-1ug/ml; Tested Species: Human; Mouse; Rat; Antigen Retrieval: By Heat; ; Tested Species: In-house tested species with positive results.; Predicted Species: Species predicted to be fit for the product based on sequence similarities.; By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.; ; Other applications have not been tested. Optimal dilutions should be determined by end users.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ANGPTL2 (275-312aa WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD), different from the related mouse sequence by one amino acid.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of ANGPTL2 expression in rat stomach extract (lane 1) and mouse ovary extract (lane 2). ANGPTL2 at 57KD was detected using rabbit anti- ANGPTL2 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(ANGPTL2 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- ANGPTL2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(ANGPTL2 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- ANGPTL2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(ANGPTL2 was detected in paraffin-embedded sections of rat cardiac muscle tissues using rabbit anti- ANGPTL2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(ANGPTL2 was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- ANGPTL2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Related Product Information for anti-ANGPTL2 antibody

Rabbit IgG polyclonal antibody for Angiopoietin-related protein 2(ANGPTL2) detection.
Background: Angiopoietin-related protein 2, also known as angiopoietin-like protein 2, is a protein that in humans is encoded by the ANGPTL2 gene. Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action.

References

1. "Entrez Gene: ANGPTL2 angiopoietin-like 2".
2. Kim I, Moon SO, Koh KN, Kim H, Uhm CS, Kwak HJ, Kim NG, Koh GY (Oct 1999). "Molecular cloning, expression, and characterization of angiopoietin-related protein. angiopoietin-related protein induces endothelial cell sprouting". J Biol Chem. 274 (37): 26523-8.
3. Sun H, Zheng JM, Chen S, et al. (2007). "Enhanced expression of ANGPTL2 in the microvascular lesions of diabetic glomerulopathy". Nephron Exp. Nephrol.105 (4): e117-23.

NCBI and Uniprot Product Information

• NCBI GI #: 6912236
• NCBI GeneID: 23452
• NCBI Accession #: NP_036230.1
• NCBI GenBank Nucleotide #: NM_012098.2
• UniProt Accession #: Q9UKU9; Q5JT58; Q8NCH7
• Molecular Weight: 22,717 Da
• NCBI Official Full Name: angiopoietin-related protein 2
• NCBI Official Synonym Full Names: angiopoietin like 2
• NCBI Official Symbol: ANGPTL2
• NCBI Official Synonym Symbols: ARP2; HARP
• NCBI Protein Information: angiopoietin-related protein 2
• UniProt Protein Name: Angiopoietin-related protein 2
• Protein Family: Angiopoietin-related protein
• UniProt Gene Name: ANGPTL2
• UniProt Synonym Gene Names: ARP2

NCBI Description

Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action. [provided by RefSeq, Jul 2008]

Uniprot Description

ANGPTL2: Induces sprouting in endothelial cells through an autocrine and paracrine action.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 9q33.3

Molecular Function: receptor binding

Biological Process: multicellular organismal development