Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ANGPT4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit anti-Human ANGPT4 Polyclonal Antibody | anti-ANGPT4 antibody

ANGPT4 antibody - N-terminal region

Gene Names
ANGPT4; ANG3; ANG4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ANGPT4; Polyclonal Antibody; ANGPT4 antibody - N-terminal region; anti-ANGPT4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPT
Sequence Length
503
Applicable Applications for anti-ANGPT4 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ANGPT4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ANGPT4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-ANGPT4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-ANGPT4 antibody
This is a rabbit polyclonal antibody against ANGPT4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The mechanism by which they contribute to angiogenesis

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
angiopoietin-4 isoform 1
NCBI Official Synonym Full Names
angiopoietin 4
NCBI Official Symbol
ANGPT4
NCBI Official Synonym Symbols
ANG3; ANG4
NCBI Protein Information
angiopoietin-4
UniProt Protein Name
Angiopoietin-4
Protein Family
UniProt Gene Name
ANGPT4
UniProt Synonym Gene Names
ANG3; ANG4; ANG-4; ANG-3
UniProt Entry Name
ANGP4_HUMAN

NCBI Description

Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The mechanism by which they contribute to angiogenesis is thought to involve regulation of endothelial cell interactions with supporting perivascular cells. The protein encoded by this gene functions as an agonist and is an angiopoietin. [provided by RefSeq, Jul 2008]

Uniprot Description

ANGPT4: Binds to TEK/TIE2, modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2. Promotes endothelial cell survival, migration and angiogenesis.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: extracellular space; extracellular region

Molecular Function: transmembrane receptor protein tyrosine kinase activator activity; receptor tyrosine kinase binding

Biological Process: negative regulation of angiogenesis; positive regulation of angiogenesis; positive regulation of peptidyl-tyrosine phosphorylation; transmembrane receptor protein tyrosine kinase activation (dimerization); endothelial cell proliferation; positive regulation of blood vessel endothelial cell migration; angiogenesis; blood coagulation; negative regulation of blood vessel endothelial cell migration; leukocyte migration; negative regulation of apoptosis

Research Articles on ANGPT4

Similar Products

Product Notes

The ANGPT4 angpt4 (Catalog #AAA3213007) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANGPT4 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANGPT4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ANGPT4 angpt4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLVVQHGHCS YTFLLPKSEP CPPGPEVSRD SNTLQRESLA NPLHLGKLPT. It is sometimes possible for the material contained within the vial of "ANGPT4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.