Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- AMPK beta 2 Picoband antibody, MBS178315, Western blottingAll lanes: Anti AMPK beta 2 (MBS178315) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Skeletal Muscle Tissue Lysate at 50ugLane 3: PANC Whole Cell Lysate at 40ugPredicted bind size: 30KDObserved bind size: 30KD)

AMPK beta 2 Polyclonal Antibody | anti-AMPK beta 2 antibody

Anti-AMPK beta 2 Antibody

Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry, Immunocytochemistry, Flow Cytometry
Purity
Immunogen Affinity Purified
Synonyms
AMPK beta 2; Polyclonal Antibody; Anti-AMPK beta 2 Antibody; 5'-AMP-activated protein kinase subunit beta-2; 5' AMP activated protein kinase beta 2 subunit; 5' AMP activated protein kinase subunit beta 2; 5''-AMP-activated protein kinase subunit beta-2; AAKB2_HUMAN; AMP activated protein kinase beta 2 non catalytic subunit; AMPK beta 2 chain; AMPK subunit beta 2; AMPK subunit beta-2; MGC61468; PRKAB 2; Prkab2; Protein kinase AMP activated beta 2 non catalytic subunit; protein kinase; AMP-activated; beta 2 non-catalytic subunit; anti-AMPK beta 2 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
No cross reactivity with other proteins
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
272
Applicable Applications for anti-AMPK beta 2 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-p), Immunohistochemistry-Frozen (IHC-Fr), Immunocytochemistry (ICC), Flow Cytometry (FC)
Application Notes
WB: Concentration: 0.1-0.5ug/ml; Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1ug/ml; Tested Species: Human, Mouse; Rat; Antigen Retrieval: By Heat
IHC-F: Concentration: 0.5-1ug/mL; Tested Species: Human
FC: Concentration: 1-3ug/1x106cells; Tested Species: Human

Tested Species: In house tested species with positives results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56-89aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, store at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- AMPK beta 2 Picoband antibody, MBS178315, Western blottingAll lanes: Anti AMPK beta 2 (MBS178315) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Skeletal Muscle Tissue Lysate at 50ugLane 3: PANC Whole Cell Lysate at 40ugPredicted bind size: 30KDObserved bind size: 30KD)

Western Blot (WB) (Anti- AMPK beta 2 Picoband antibody, MBS178315, Western blottingAll lanes: Anti AMPK beta 2 (MBS178315) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Skeletal Muscle Tissue Lysate at 50ugLane 3: PANC Whole Cell Lysate at 40ugPredicted bind size: 30KDObserved bind size: 30KD)

Immunohistochemistry (IHC)

(Anti- AMPK beta 2 Picoband antibody, MBS178315, IHC(P)IHC(P): Mouse Intestine Tissue )

Immunohistochemistry (IHC) (Anti- AMPK beta 2 Picoband antibody, MBS178315, IHC(P)IHC(P): Mouse Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- AMPK beta 2 Picoband antibody, MBS178315, IHC(P)IHC(P): Rat Intestine Tissue )

Immunohistochemistry (IHC) (Anti- AMPK beta 2 Picoband antibody, MBS178315, IHC(P)IHC(P): Rat Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- AMPK beta 2 Picoband antibody, MBS178315, IHC(P)IHC(P): Human Lung Cancer Tissue )

Immunohistochemistry (IHC) (Anti- AMPK beta 2 Picoband antibody, MBS178315, IHC(P)IHC(P): Human Lung Cancer Tissue )
Related Product Information for anti-AMPK beta 2 antibody
Description: Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-2(PRKAB2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: 5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene.
References
1. "Entrez Gene: PRKAB2 protein kinase, AMP-activated, beta 2 non-catalytic subunit". 2. Stapleton D, Mitchelhill KI, Gao G, Widmer J, Michell BJ, Teh T, House CM, Fernandez CS, Cox T, Witters LA, Kemp BE (February 1996). "Mammalian AMP-activated protein kinase subfamily". J Biol Chem 271 (2): 611-4.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
5'-AMP-activated protein kinase subunit beta-2
NCBI Official Synonym Full Names
protein kinase AMP-activated non-catalytic subunit beta 2
NCBI Official Symbol
PRKAB2
NCBI Protein Information
5'-AMP-activated protein kinase subunit beta-2
UniProt Protein Name
5'-AMP-activated protein kinase subunit beta-2
UniProt Gene Name
PRKAB2
UniProt Synonym Gene Names
AMPK subunit beta-2
UniProt Entry Name
AAKB2_HUMAN

NCBI Description

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2013]

Uniprot Description

AMPKB2: a non-catalytic subunit of AMPK, a conserved kinase of the CAMKL family. AMPK is an energy-sensing protein that plays a key role in regulating cellular energy homeostasis. Environmental stress, such as heat shock, nutrient deprivation, hypoxia and ischemia, indirectly activate AMPK by the depletion of cellular ATP and the concomitant rise of ADP and AMP levels. Allosteric activation is achieved primarily by rising ADP levels, and not solely by AMP levels as previously thought. Activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton, probably by indirectly activating myosin. AMPK is a heterotrimer of an alpha catalytic subunit (AMPKA1 or -2), a beta (AMPKB1 or -2) and a gamma non-catalytic subunit (AMPKG1, -2 or -3). Different possible combinations of subunits give rise to 12 different holoenzymes. Beta subunits act as scaffolds on which the AMPK complex assembles, via its C-terminus that bridges alpha and gamma subunits. AMPK-beta1 or -beta2 subunits are required for assembling of AMPK heterotrimers and are important for regulating enzyme activity and cellular localization. AMPK beta1beta2 null mouse muscles reveal an essential role for AMPK in maintaining mitochondrial content and glucose uptake during exercise. Phosphorylation by ULK1 and ULK2 inhibits AMPK activity.

Protein type: Autophagy; Protein kinase, regulatory subunit

Chromosomal Location of Human Ortholog: 1q21.1

Cellular Component: AMP-activated protein kinase complex; cAMP-dependent protein kinase complex; cytosol; nucleoplasm

Molecular Function: AMP-activated protein kinase activity; identical protein binding; protein binding; protein kinase binding

Biological Process: carnitine shuttle; cell cycle arrest; fatty acid biosynthetic process; macroautophagy; protein amino acid phosphorylation; regulation of fatty acid biosynthetic process; regulation of protein kinase activity; signal transduction

Research Articles on AMPK beta 2

Similar Products

Product Notes

The AMPK beta 2 prkab2 (Catalog #AAA178315) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-AMPK beta 2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AMPK beta 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-p), Immunohistochemistry-Frozen (IHC-Fr), Immunocytochemistry (ICC), Flow Cytometry (FC). WB: Concentration: 0.1-0.5ug/ml; Tested Species: Human, Rat IHC-P: Concentration: 0.5-1ug/ml; Tested Species: Human, Mouse; Rat; Antigen Retrieval: By Heat IHC-F: Concentration: 0.5-1ug/mL; Tested Species: Human FC: Concentration: 1-3ug/1x106cells; Tested Species: Human Tested Species: In house tested species with positives results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Researchers should empirically determine the suitability of the AMPK beta 2 prkab2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AMPK beta 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.