Rabbit anti-Human AMELX Polyclonal Antibody | anti-AMELX antibody

AMELX (Amelogenin, X Isoform, AMG, AMGX) (HRP)

Cat. Num. AAA6369719

• Gene Names: AMELX; AMG; AI1E; AIH1; ALGN; AMGL; AMGX
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AMELX; Polyclonal Antibody; AMELX (Amelogenin; X Isoform; AMG; AMGX) (HRP); anti-AMELX antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human AMELX.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-AMELX antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human AMELX, aa1-191 (NP_001133.1).
• Immunogen Sequence: MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of AMELX expression in transfected 293T cell line by AMELX polyclonal antibody. Lane 1: AMELX transfected lysate (21.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-AMELX antibody

Amelx (amelogenin X chromosome) is an extracellular matrix protein secreted by ameloblasts and is a major component of enamel matrix. The Amelogenin plays a role in the biomineralization of teeth. It seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. The protein is also thought to play a major role in the structural organization and mineralization of developing enamel. Recently, in addition to their role in enamel formation, the biological activity of enamel proteins in the process of cell differentiation has recently become widely appreciated.

Product Categories/Family for anti-AMELX antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4502071
• NCBI GeneID: 265
• NCBI Accession #: NP_001133.1
• NCBI GenBank Nucleotide #: NM_001142.2
• UniProt Accession #: Q99217; Q96NW6; Q9UCA7
• NCBI Official Full Name: amelogenin, X isoform isoform 1
• NCBI Official Synonym Full Names: amelogenin, X-linked
• NCBI Official Symbol: AMELX
• NCBI Official Synonym Symbols: AMG; AI1E; AIH1; ALGN; AMGL; AMGX
• NCBI Protein Information: amelogenin, X isoform; amelogenesis imperfecta 1; amelogenin (X chromosome, amelogenesis imperfecta 1); amelogenin (amelogenesis imperfecta 1, X-linked)
• UniProt Protein Name: Amelogenin, X isoform
• Protein Family: Amelogenin
• UniProt Gene Name: AMELX
• UniProt Synonym Gene Names: AMG; AMGX
• UniProt Entry Name: AMELX_HUMAN

NCBI Description

This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in this gene cause X-linked amelogenesis imperfecta. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

AMELX: Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel. Defects in AMELX are the cause of amelogenesis imperfecta type 1E (AI1E). A X-linked defect of dental enamel formation. Teeth have only a thin layer of enamel with normal hardness. The thinness of the enamel makes the teeth appear small. Belongs to the amelogenin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: Xp22.31-p22.1

Cellular Component: proteinaceous extracellular matrix; cell surface

Molecular Function: identical protein binding; protein binding; growth factor activity; hydroxyapatite binding; structural constituent of tooth enamel

Biological Process: osteoblast differentiation; cell proliferation; ion homeostasis; biomineral formation; positive regulation of collagen biosynthetic process; chondrocyte differentiation; epithelial to mesenchymal transition; signal transduction; cell adhesion; odontogenesis of dentine-containing teeth

Disease: Amelogenesis Imperfecta, Type Ie