Western Blot (WB)
(WB Suggested Anti-Ambp Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Rat Lung)
Rabbit Ambp Polyclonal Antibody | anti-AMBP antibody
Ambp antibody - N-terminal region
Gene Names
Ambp; UTI
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Ambp; Polyclonal Antibody; Ambp antibody - N-terminal region; anti-AMBP antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ATLESYVVHTNYDEYAIFLTKKFSHRHGPTITAKLYGREPQLRDSLLQEF
Sequence Length
349
Applicable Applications for anti-AMBP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Ambp Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Rat Lung)
Western Blot (WB)
(WB Suggested Anti-Ambp Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Rat Lung)
Related Product Information for anti-AMBP antibody
This is a rabbit polyclonal antibody against Ambp. It was validated on Western Blot
Target Description: Inter-alpha-trypsin inhibitor inhibits trypsin, plasmin, and lysosomal granulocytic elastase. Inhibits calcium oxalate crystallization.Trypstatin is a trypsin inhibitor. It inhibits blood coagulation factor Xa and tryptase about 100-fold more rapidly than porcine pancreatic trypsin and chymase.
Target Description: Inter-alpha-trypsin inhibitor inhibits trypsin, plasmin, and lysosomal granulocytic elastase. Inhibits calcium oxalate crystallization.Trypstatin is a trypsin inhibitor. It inhibits blood coagulation factor Xa and tryptase about 100-fold more rapidly than porcine pancreatic trypsin and chymase.
Product Categories/Family for anti-AMBP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
protein AMBP
NCBI Official Synonym Full Names
alpha-1-microglobulin/bikunin precursor
NCBI Official Symbol
Ambp
NCBI Official Synonym Symbols
UTI
NCBI Protein Information
protein AMBP
UniProt Protein Name
Protein AMBP
Protein Family
UniProt Gene Name
Ambp
UniProt Synonym Gene Names
Itil; ITI-LC
NCBI Description
may play a role in regulation of immune response [RGD, Feb 2006]
Uniprot Description
Inter-alpha-trypsin inhibitor inhibits trypsin, plasmin, and lysosomal granulocytic elastase. Inhibits calcium oxalate crystallization ().
Similar Products
Product Notes
The AMBP ambp (Catalog #AAA3206137) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ambp antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Ambp can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AMBP ambp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ATLESYVVHT NYDEYAIFLT KKFSHRHGPT ITAKLYGREP QLRDSLLQEF. It is sometimes possible for the material contained within the vial of "Ambp, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
