Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of Alpha Defensin 1 expression in rat testis extract (lane 1) and HELA whole cell lysates (lane 2). Alpha Defensin 1 at 19KD was detected using rabbit anti- Alpha Defensin 1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Human, Rat Alpha Defensin 1 Polyclonal Antibody | anti-DEFA1 antibody

Anti-Alpha Defensin 1 Antibody

Gene Names
DEFA1B; HP1; HP-1; HNP-1
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
Alpha Defensin 1; Polyclonal Antibody; Anti-Alpha Defensin 1 Antibody; DEF1; DEFA1; DEFA1B; DEFA2; Defensin 1; Defensin; HNP-1; HNP-2; HNP1; HP-1; HP-2; HP1; HP2; MRS; P59665; Neutrophil defensin 1; defensin alpha 1; anti-DEFA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4mg Trehalouse, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
94
Applicable Applications for anti-DEFA1 antibody
Western Blot (WB)
Application Notes
Western Blot:
Concentration: 0.1-0.5ug/ml
Tested Species: Hu, Rat

Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be deteremined by end users.
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Alpha Defensin 1 (65-94aa ACYCRIPACIAGERRYGTCIYQGRLWAFCC).
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of Alpha Defensin 1 expression in rat testis extract (lane 1) and HELA whole cell lysates (lane 2). Alpha Defensin 1 at 19KD was detected using rabbit anti- Alpha Defensin 1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of Alpha Defensin 1 expression in rat testis extract (lane 1) and HELA whole cell lysates (lane 2). Alpha Defensin 1 at 19KD was detected using rabbit anti- Alpha Defensin 1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-DEFA1 antibody
Rabbit IgG polyclonal antibody for Neutrophil defensin 1(DEFA1) detection.
Background: Defensin, alpha 1, also known as human alpha defensin 1, human neutrophil peptide 1 (HNP-1) or neutrophil defensin 1 is a human protein that is encoded by the DEFA1 gene. Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation.
References
1. "Entrez Gene: DEFA1 defensin, alpha 1".
2. Aldred PM, Hollox EJ, Armour JA (Jul 2005). "Copy number polymorphism and expression level variation of the human alpha-defensin genes DEFA1 and DEFA3".Hum Mol Genet. 14 (14): 2045-52.
3. Feng Y, Gutekunst CA, Eberhart DE, Yi H, Warren ST, Hersch SM (Mar 1997). "Fragile X mental retardation protein: nucleocytoplasmic shuttling and association with somatodendritic ribosomes". J Neurosci. 17 (5): 1539-47.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
neutrophil defensin 1 isoform 2 preproprotein
NCBI Official Synonym Full Names
defensin alpha 1B
NCBI Official Symbol
DEFA1B
NCBI Official Synonym Symbols
HP1; HP-1; HNP-1
NCBI Protein Information
neutrophil defensin 1
UniProt Protein Name
Neutrophil defensin 1
Protein Family
UniProt Gene Name
DEFA1
UniProt Synonym Gene Names
DEF1; DEFA2; MRS; HP-1; HP1; HP-2; HP2

NCBI Description

Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2014]

Uniprot Description

defensin, alpha 1: Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram- negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. Belongs to the alpha-defensin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 8p23.1

Cellular Component: extracellular matrix; extracellular region; extracellular space; Golgi lumen

Biological Process: antibacterial humoral response; chemotaxis; defense response to Gram-positive bacterium; estrogen receptor signaling pathway; immune response; innate immune response; innate immune response in mucosa

Research Articles on DEFA1

Similar Products

Product Notes

The DEFA1 defa1 (Catalog #AAA178711) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Alpha Defensin 1 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Alpha Defensin 1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: Concentration: 0.1-0.5ug/ml Tested Species: Hu, Rat Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be deteremined by end users. Researchers should empirically determine the suitability of the DEFA1 defa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Alpha Defensin 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.