Western Blot (WB)
(ALOX15 rabbit polyclonal antibody. Western Blot analysis of ALOX15 expression in mouse spleen.)
Rabbit anti-Human, Mouse ALOX15 Polyclonal Antibody | anti-ALOX15 antibody
ALOX15 (Arachidonate 15-lipoxygenase, 15-LOX, Arachidonate omega-6 Lipoxygenase, LOG15) (Biotin)
Gene Names
ALOX15; LOG15; 12-LOX; 15-LOX; 15-LOX-1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ALOX15; Polyclonal Antibody; ALOX15 (Arachidonate 15-lipoxygenase; 15-LOX; Arachidonate omega-6 Lipoxygenase; LOG15) (Biotin); anti-ALOX15 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ALOX15. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
2707
Applicable Applications for anti-ALOX15 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ALOX15, aa1-662 (AAH29032.1).
Immunogen Sequence
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(ALOX15 rabbit polyclonal antibody. Western Blot analysis of ALOX15 expression in mouse spleen.)
Western Blot (WB)
(ALOX15 rabbit polyclonal antibody. Western Blot analysis of ALOX15 expression in mouse spleen.)
Western Blot (WB)
(Western Blot analysis of ALOX15 expression in transfected 293T cell line by ALOX15 polyclonal antibody. Lane 1: ALOX15 transfected lysate (74.8kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of ALOX15 expression in transfected 293T cell line by ALOX15 polyclonal antibody. Lane 1: ALOX15 transfected lysate (74.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ALOX15 antibody
ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. The protein also acts on C-12 of arachidonate as well as on linoleic acid.
Product Categories/Family for anti-ALOX15 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens arachidonate 15-lipoxygenase, mRNA
NCBI Official Synonym Full Names
arachidonate 15-lipoxygenase
NCBI Official Symbol
ALOX15
NCBI Official Synonym Symbols
LOG15; 12-LOX; 15-LOX; 15-LOX-1
NCBI Protein Information
arachidonate 15-lipoxygenase
NCBI Description
This gene encodes a member of the lipoxygenase family of proteins. The encoded enzyme acts on various polyunsaturated fatty acid substrates to generate various bioactive lipid mediators such as eicosanoids, hepoxilins, lipoxins, and other molecules. The encoded enzyme and its reaction products have been shown to regulate inflammation and immunity. Multiple pseudogenes of this gene have been identified in the human genome. [provided by RefSeq, Aug 2017]
Research Articles on ALOX15
Similar Products
Product Notes
The ALOX15 (Catalog #AAA6369640) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALOX15 (Arachidonate 15-lipoxygenase, 15-LOX, Arachidonate omega-6 Lipoxygenase, LOG15) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ALOX15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ALOX15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ALOX15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
