Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-ALDH3A2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult AdrenalObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit ALDH3A2 Polyclonal Antibody | anti-ALDH3A2 antibody

ALDH3A2 antibody - middle region

Gene Names
ALDH3A2; SLS; FALDH; ALDH10
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ALDH3A2; Polyclonal Antibody; ALDH3A2 antibody - middle region; anti-ALDH3A2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR
Sequence Length
508
Applicable Applications for anti-ALDH3A2 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ALDH3A2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-ALDH3A2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult AdrenalObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-ALDH3A2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult AdrenalObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: RabbitTarget Name: ALDH3A2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ALDH3A2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ALDH3A2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ALDH3A2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-ALDH3A2 AntibodyPositive Control: Lane1: 30ug human primary hepatocytesPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:5000Submitted by: Takeshi Saito, USC Keck School of Medicine)

Western Blot (WB) (WB Suggested Anti-ALDH3A2 AntibodyPositive Control: Lane1: 30ug human primary hepatocytesPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:5000Submitted by: Takeshi Saito, USC Keck School of Medicine)

Western Blot (WB)

(WB Suggested Anti-ALDH3A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: NCI-H226 cell lysate)

Western Blot (WB) (WB Suggested Anti-ALDH3A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: NCI-H226 cell lysate)
Related Product Information for anti-ALDH3A2 antibody
This is a rabbit polyclonal antibody against ALDH3A2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. ALDH3A2 catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid.
Product Categories/Family for anti-ALDH3A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
224
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
Fatty aldehyde dehydrogenase
NCBI Official Synonym Full Names
aldehyde dehydrogenase 3 family member A2
NCBI Official Symbol
ALDH3A2
NCBI Official Synonym Symbols
SLS; FALDH; ALDH10
NCBI Protein Information
fatty aldehyde dehydrogenase
UniProt Protein Name
Fatty aldehyde dehydrogenase
UniProt Gene Name
ALDH3A2
UniProt Synonym Gene Names
ALDH10; FALDH
UniProt Entry Name
AL3A2_HUMAN

NCBI Description

Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This gene product catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid. Mutations in the gene cause Sjogren-Larsson syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ALDH3A2: Catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acids. Active on a variety of saturated and unsaturated aliphatic aldehydes between 6 and 24 carbons in length. Responsible for conversion of the sphingosine 1-phosphate (S1P) degradation product hexadecenal to hexadecenoic acid. Defects in ALDH3A2 are the cause of Sjoegren-Larsson syndrome (SLS). SLS is an autosomal recessive neurocutaneous disorder characterized by a combination of severe mental retardation, spastic di- or tetraplegia and congenital ichthyosis (increased keratinization). Ichthyosis is usually evident at birth, neurologic symptoms appear in the first or second year of life. Most patients have an IQ of less than 60. Additional clinical features include glistening white spots on the retina, seizures, short stature and speech defects. Belongs to the aldehyde dehydrogenase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Carbohydrate Metabolism - propanoate; Amino Acid Metabolism - histidine; Membrane protein, integral; Oxidoreductase; EC 1.2.1.3; Amino Acid Metabolism - lysine degradation; Carbohydrate Metabolism - ascorbate and aldarate; Carbohydrate Metabolism - pyruvate; Carbohydrate Metabolism - butanoate; Other Amino Acids Metabolism - beta-alanine; Lipid Metabolism - fatty acid; Amino Acid Metabolism - arginine and proline; Secondary Metabolites Metabolism - limonene and pinene degradation; Lipid Metabolism - glycerolipid; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Amino Acid Metabolism - tryptophan; Amino Acid Metabolism - valine, leucine and isoleucine degradation; Mitochondrial

Chromosomal Location of Human Ortholog: 17p11.2

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle; mitochondrial inner membrane; integral to membrane; peroxisome

Molecular Function: long-chain-alcohol oxidase activity; aldehyde dehydrogenase (NAD) activity; aldehyde dehydrogenase [NAD(P)+] activity; 3-chloroallyl aldehyde dehydrogenase activity; long-chain-aldehyde dehydrogenase activity

Biological Process: phytol metabolic process; epidermis development; central nervous system development; aldehyde metabolic process; sesquiterpenoid metabolic process; peripheral nervous system development

Disease: Sjogren-larsson Syndrome

Research Articles on ALDH3A2

Similar Products

Product Notes

The ALDH3A2 aldh3a2 (Catalog #AAA3207290) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALDH3A2 antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ALDH3A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ALDH3A2 aldh3a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DHIFYTGNTA VGKIVMEAAA KHLTPVTLEL GGKSPCYIDK DCDLDIVCRR. It is sometimes possible for the material contained within the vial of "ALDH3A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.