Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Kidney)

Rabbit ALB Polyclonal Antibody | anti-ALB antibody

ALB antibody - N-terminal region

Gene Names
ALB; HSA; PRO0883; PRO0903; PRO1341
Reactivity
Guinea Pig, Horse, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ALB; Polyclonal Antibody; ALB antibody - N-terminal region; anti-ALB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEET
Sequence Length
609
Applicable Applications for anti-ALB antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Guinea Pig: 100%; Horse: 82%; Human: 100%; Mouse: 90%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ALB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Kidney)

Immunohistochemistry (IHC) (Kidney)
Related Product Information for anti-ALB antibody
This is a rabbit polyclonal antibody against ALB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin. Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
213
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
serum albumin preproprotein
NCBI Official Synonym Full Names
albumin
NCBI Official Symbol
ALB
NCBI Official Synonym Symbols
HSA; PRO0883; PRO0903; PRO1341
NCBI Protein Information
serum albumin
UniProt Protein Name
Serum albumin
Protein Family
UniProt Gene Name
ALB
UniProt Entry Name
ALBU_HUMAN

NCBI Description

This gene encodes the most abundant protein in human blood. This protein functions in the regulation of blood plasma colloid osmotic pressure and acts as a carrier protein for a wide range of endogenous molecules including hormones, fatty acids, and metabolites, as well as exogenous drugs. Additionally, this protein exhibits an esterase-like activity with broad substrate specificity. The encoded preproprotein is proteolytically processed to generate the mature protein. A peptide derived from this protein, EPI-X4, is an endogenous inhibitor of the CXCR4 chemokine receptor. [provided by RefSeq, Jul 2016]

Uniprot Description

albumin: Serum albumin, the main protein of plasma, has a good binding capacity for water, Ca(2+), Na(+), K(+), fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. Major zinc transporter in plasma, typically binds about 80% of all plasma zinc. Plasma. Belongs to the ALB/AFP/VDB family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Carrier; Secreted

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: extracellular space; protein complex; extracellular region; basement membrane; nucleus

Molecular Function: antioxidant activity; toxin binding; protein binding; copper ion binding; enzyme binding; DNA binding; zinc ion binding; chaperone binding; drug binding; oxygen binding; fatty acid binding; pyridoxal phosphate binding

Biological Process: platelet activation; receptor-mediated endocytosis; sodium-independent organic anion transport; bile acid metabolic process; maintenance of mitochondrion localization; lipoprotein metabolic process; hemolysis by symbiont of host red blood cells; cellular response to starvation; response to organic substance; response to mercury ion; bile acid and bile salt transport; retinal homeostasis; platelet degranulation; transport; negative regulation of programmed cell death; blood coagulation; transmembrane transport; positive regulation of circadian sleep/wake cycle, non-REM sleep; response to nutrient; negative regulation of apoptosis

Disease: Analbuminemia; Hyperthyroxinemia, Familial Dysalbuminemic

Research Articles on ALB

Similar Products

Product Notes

The ALB alb (Catalog #AAA3206012) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALB antibody - N-terminal region reacts with Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ALB can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ALB alb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YGEMADCCAK QEPERNECFL QHKDDNPNLP RLVRPEVDVM CTAFHDNEET. It is sometimes possible for the material contained within the vial of "ALB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.