Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AKR1A1 AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)

Rabbit AKR1A1 Polyclonal Antibody | anti-AKR1A1 antibody

AKR1A1 antibody - N-terminal region

Gene Names
AKR1A1; ALR; ARM; DD3; ALDR1; HEL-S-6
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AKR1A1; Polyclonal Antibody; AKR1A1 antibody - N-terminal region; anti-AKR1A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YGNEPEIGEALKEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTL
Sequence Length
325
Applicable Applications for anti-AKR1A1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 92%; Rabbit: 93%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AKR1A1 AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)

Western Blot (WB) (WB Suggested Anti-AKR1A1 AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)
Related Product Information for anti-AKR1A1 antibody
This is a rabbit polyclonal antibody against AKR1A1. It was validated on Western Blot

Target Description: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present in virtually every tissue. Multiple alternatively spliced transcript variants of this gene exist, all encoding the same protein.
Product Categories/Family for anti-AKR1A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
aldo-keto reductase family 1 member A1
NCBI Official Synonym Full Names
aldo-keto reductase family 1 member A1
NCBI Official Symbol
AKR1A1
NCBI Official Synonym Symbols
ALR; ARM; DD3; ALDR1; HEL-S-6
NCBI Protein Information
aldo-keto reductase family 1 member A1; alcohol dehydrogenase [NADP(+)]
UniProt Protein Name
Alcohol dehydrogenase [NADP(+)]
Protein Family
UniProt Gene Name
AKR1A1
UniProt Synonym Gene Names
ALDR1; ALR
UniProt Entry Name
AK1A1_HUMAN

NCBI Description

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present in virtually every tissue. Multiple alternatively spliced transcript variants of this gene exist, all encoding the same protein. [provided by RefSeq, Jan 2011]

Uniprot Description

AKR1A1: Catalyzes the NADPH-dependent reduction of a variety of aromatic and aliphatic aldehydes to their corresponding alcohols. Catalyzes the reduction of mevaldate to mevalonic acid and of glyceraldehyde to glycerol. Has broad substrate specificity. In vitro substrates include succinic semialdehyde, 4- nitrobenzaldehyde, 1,2-naphthoquinone, methylglyoxal, and D- glucuronic acid. Plays a role in the activation of procarcinogens, such as polycyclic aromatic hydrocarbon trans-dihydrodiols, and in the metabolism of various xenobiotics and drugs, including the anthracyclines doxorubicin (DOX) and daunorubicin (DAUN). Belongs to the aldo/keto reductase family.

Protein type: Carbohydrate Metabolism - glycolysis and gluconeogenesis; EC 1.1.1.2; Lipid Metabolism - glycerolipid; Oxidoreductase

Chromosomal Location of Human Ortholog: 1p33-p32

Cellular Component: extracellular space; apical plasma membrane; cytosol

Molecular Function: L-glucuronate reductase activity; electron carrier activity; aldehyde reductase activity

Biological Process: aldehyde catabolic process; L-ascorbic acid biosynthetic process; D-glucuronate catabolic process; glucose metabolic process; aldehyde metabolic process

Research Articles on AKR1A1

Similar Products

Product Notes

The AKR1A1 akr1a1 (Catalog #AAA3216452) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AKR1A1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AKR1A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AKR1A1 akr1a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YGNEPEIGEA LKEDVGPGKA VPREELFVTS KLWNTKHHPE DVEPALRKTL. It is sometimes possible for the material contained within the vial of "AKR1A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.