Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of AKAP7 expression in transfected 293T cell line by AKAP7 polyclonal antibody. Lane 1: AKAP7 transfected lysate (11.5kD). Lane 2: Non-transfected lysate.)

Rabbit AKAP7 Polyclonal Antibody | anti-AKAP7 antibody

AKAP7 (A-kinase Anchor Protein 7 Isoforms alpha and beta, AKAP-7 Isoforms alpha and beta, Protein Kinase A-anchoring Protein 7 Isoforms alpha/beta, A-kinase Anchor Protein 18kD, AKAP 18, AKAP18) (PE)

Gene Names
AKAP7; AKAP15; AKAP18
Reactivity
Human, Rabbit
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AKAP7; Polyclonal Antibody; AKAP7 (A-kinase Anchor Protein 7 Isoforms alpha and beta; AKAP-7 Isoforms alpha and beta; Protein Kinase A-anchoring Protein 7 Isoforms alpha/beta; A-kinase Anchor Protein 18kD; AKAP 18; AKAP18) (PE); anti-AKAP7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rabbit
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human AKAP7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
104
Applicable Applications for anti-AKAP7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human AKAP7, aa1-104 (NP_619539.1).
Immunogen Sequence
MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of AKAP7 expression in transfected 293T cell line by AKAP7 polyclonal antibody. Lane 1: AKAP7 transfected lysate (11.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AKAP7 expression in transfected 293T cell line by AKAP7 polyclonal antibody. Lane 1: AKAP7 transfected lysate (11.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-AKAP7 antibody
AKAP7 is a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations.
Product Categories/Family for anti-AKAP7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
A-kinase anchoring protein 7 isoform beta
NCBI Official Synonym Full Names
A-kinase anchoring protein 7
NCBI Official Symbol
AKAP7
NCBI Official Synonym Symbols
AKAP15; AKAP18
NCBI Protein Information
A-kinase anchoring protein 7
UniProt Protein Name
A-kinase anchor protein 7 isoforms alpha and beta
Protein Family
UniProt Gene Name
AKAP7
UniProt Synonym Gene Names
AKAP15; AKAP18; AKAP-7 isoforms alpha and beta; AKAP 18; PRKA7 isoforms alpha/beta
UniProt Entry Name
AKA7A_HUMAN

NCBI Description

This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Apr 2011]

Uniprot Description

AKAP7 iso1: Probably targets cAMP-dependent protein kinase (PKA) to the cellular membrane or cytoskeletal structures. The membrane- associated form reduces epithelial sodium channel (ENaC) activity, whereas the free cytoplasmic form may negatively regulate ENaC channel feedback inhibition by intracellular sodium. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 6q23

Cellular Component: apical plasma membrane; plasma membrane; cytosol; nucleus; lateral plasma membrane

Molecular Function: protein binding; protein kinase A binding; nucleotide binding; protein kinase binding

Biological Process: regulation of action potential; protein localization; ion transport

Research Articles on AKAP7

Similar Products

Product Notes

The AKAP7 akap7 (Catalog #AAA6369263) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AKAP7 (A-kinase Anchor Protein 7 Isoforms alpha and beta, AKAP-7 Isoforms alpha and beta, Protein Kinase A-anchoring Protein 7 Isoforms alpha/beta, A-kinase Anchor Protein 18kD, AKAP 18, AKAP18) (PE) reacts with Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's AKAP7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKAP7 akap7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKAP7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.