Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: AKAP3Sample Tissue: Human COLO205 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human AKAP3 Polyclonal Antibody | anti-AKAP3 antibody

AKAP3 Antibody - middle region

Gene Names
AKAP3; CT82; SOB1; FSP95; PRKA3; HEL159; AKAP110; AKAP 110
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
AKAP3; Polyclonal Antibody; AKAP3 Antibody - middle region; anti-AKAP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGSGDRVSGSSQSPPNLKYKSTLKIKESTKERQGPDDKPPSKKSFFYKEV
Sequence Length
853
Applicable Applications for anti-AKAP3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AKAP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: AKAP3Sample Tissue: Human COLO205 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: AKAP3Sample Tissue: Human COLO205 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-AKAP3 antibody
This gene encodes a member of A-kinase anchoring proteins (AKAPs), a family of functionally related proteins that target protein kinase A to discrete locations within the cell. The encoded protein is reported to participate in protein-protein interactions with the R-subunit of the protein kinase A as well as sperm-associated proteins. This protein is expressed in spermatozoa and localized to the acrosomal region of the sperm head as well as the length of the principal piece. It may function as a regulator of motility, capacitation, and the acrosome reaction.
Product Categories/Family for anti-AKAP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95 kDa
NCBI Official Full Name
A-kinase anchor protein 3
NCBI Official Synonym Full Names
A-kinase anchoring protein 3
NCBI Official Symbol
AKAP3
NCBI Official Synonym Symbols
CT82; SOB1; FSP95; PRKA3; HEL159; AKAP110; AKAP 110
NCBI Protein Information
A-kinase anchor protein 3
UniProt Protein Name
A-kinase anchor protein 3
Protein Family
UniProt Gene Name
AKAP3
UniProt Synonym Gene Names
AKAP110; SOB1; AKAP-3; AKAP 110; CT82; FSP95; PRKA3
UniProt Entry Name
AKAP3_HUMAN

NCBI Description

This gene encodes a member of A-kinase anchoring proteins (AKAPs), a family of functionally related proteins that target protein kinase A to discrete locations within the cell. The encoded protein is reported to participate in protein-protein interactions with the R-subunit of the protein kinase A as well as sperm-associated proteins. This protein is expressed in spermatozoa and localized to the acrosomal region of the sperm head as well as the length of the principal piece. It may function as a regulator of motility, capacitation, and the acrosome reaction. [provided by RefSeq, May 2013]

Uniprot Description

AKAP3: May function as a regulator of both motility- and head- associated functions such as capacitation and the acrosome reaction. Belongs to the AKAP110 family.

Protein type: Adaptor/scaffold; Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: 12p13.3

Cellular Component: cytoplasm; acrosome; nucleus

Molecular Function: protein binding; protein kinase A binding

Biological Process: protein localization; single fertilization; acrosome reaction; transmembrane receptor protein serine/threonine kinase signaling pathway; cell motility

Research Articles on AKAP3

Similar Products

Product Notes

The AKAP3 akap3 (Catalog #AAA3220541) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AKAP3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AKAP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AKAP3 akap3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGSGDRVSGS SQSPPNLKYK STLKIKESTK ERQGPDDKPP SKKSFFYKEV. It is sometimes possible for the material contained within the vial of "AKAP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.