Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: AK5Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human AK5 Polyclonal Antibody | anti-AK5 antibody

AK5 Antibody - middle region

Gene Names
AK5; AK6
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
AK5; Polyclonal Antibody; AK5 Antibody - middle region; anti-AK5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDP
Sequence Length
167
Applicable Applications for anti-AK5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AK5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: AK5Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: AK5Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-AK5 antibody
This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Product Categories/Family for anti-AK5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63 kDa
NCBI Official Full Name
adenylate kinase isoenzyme 5 isoform 2
NCBI Official Synonym Full Names
adenylate kinase 5
NCBI Official Symbol
AK5
NCBI Official Synonym Symbols
AK6
NCBI Protein Information
adenylate kinase isoenzyme 5
UniProt Protein Name
Adenylate kinase isoenzyme 5
Protein Family
UniProt Gene Name
AK5
UniProt Synonym Gene Names
AK 5
UniProt Entry Name
KAD5_HUMAN

NCBI Description

This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

AK5: Active on AMP and dAMP with ATP as a donor. When GTP is used as phosphate donor, the enzyme phosphorylates AMP, CMP, and to a small extent dCMP. Belongs to the adenylate kinase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.4.6; Nucleotide Metabolism - purine; EC 2.7.4.3; Kinase, other

Chromosomal Location of Human Ortholog: 1p31

Cellular Component: cytoplasm; microtubule organizing center; cytosol

Molecular Function: nucleoside kinase activity; nucleoside diphosphate kinase activity; adenylate kinase activity; ATP binding

Biological Process: ATP metabolic process; nucleobase, nucleoside and nucleotide interconversion; nucleobase, nucleoside and nucleotide metabolic process; nucleoside triphosphate biosynthetic process; pyrimidine ribonucleotide biosynthetic process; ADP biosynthetic process; nucleoside diphosphate phosphorylation; dADP biosynthetic process

Research Articles on AK5

Similar Products

Product Notes

The AK5 ak5 (Catalog #AAA3220620) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AK5 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AK5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AK5 ak5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SFLRNVMPEN SNFPYRRYDR LPPIHQFSIE SDTDLSETAE LIEEYEVFDP. It is sometimes possible for the material contained within the vial of "AK5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.