Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AK3L1 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)

Rabbit AK3L1 Polyclonal Antibody | anti-AK4 antibody

AK3L1 antibody - middle region

Gene Names
AK4; AK3; AK 4; AK3L1; AK3L2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
AK3L1; Polyclonal Antibody; AK3L1 antibody - middle region; anti-AK4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYK
Sequence Length
223
Applicable Applications for anti-AK4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AK3L1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AK3L1 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-AK3L1 Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-AK4 antibody
This is a rabbit polyclonal antibody against AK3L1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: AK3L1 is a member of the adenylate kinase family of enzymes. The protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides.This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
205
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
adenylate kinase 4, mitochondrial isoform a
NCBI Official Synonym Full Names
adenylate kinase 4
NCBI Official Symbol
AK4
NCBI Official Synonym Symbols
AK3; AK 4; AK3L1; AK3L2
NCBI Protein Information
adenylate kinase 4, mitochondrial
UniProt Protein Name
Adenylate kinase 4, mitochondrial
UniProt Gene Name
AK4
UniProt Entry Name
KAD4_HUMAN

NCBI Description

This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1. [provided by RefSeq, Jul 2008]

Uniprot Description

AK3L1: Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. May also be active with GTP. Belongs to the adenylate kinase family.

Protein type: Nucleotide Metabolism - purine; EC 2.7.4.10; EC 2.7.4.6; Mitochondrial; Kinase, other

Chromosomal Location of Human Ortholog: 1p31.3

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: GTP binding; nucleoside diphosphate kinase activity; adenylate kinase activity; nucleoside triphosphate adenylate kinase activity; ATP binding

Biological Process: response to drug; ATP metabolic process; nucleoside triphosphate biosynthetic process; nucleoside diphosphate phosphorylation; ADP biosynthetic process; brain development; liver development; AMP metabolic process; GTP metabolic process

Research Articles on AK4

Similar Products

Product Notes

The AK4 ak4 (Catalog #AAA3205843) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AK3L1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's AK3L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AK4 ak4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RWIHPPSGRV YNLDFNPPHV HGIDDVTGEP LVQQEDDKPE AVAARLRQYK. It is sometimes possible for the material contained within the vial of "AK3L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.