Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AIP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)

Rabbit AIP Polyclonal Antibody | anti-AIP antibody

AIP antibody - middle region

Gene Names
AIP; ARA9; XAP2; PITA1; XAP-2; FKBP16; FKBP37; SMTPHN
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AIP; Polyclonal Antibody; AIP antibody - middle region; anti-AIP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NAQEAQADFAKVLELDPALAPVVSRELQALEARIRQKDEEDKARFRGIFS
Sequence Length
330
Applicable Applications for anti-AIP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AIP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AIP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)

Western Blot (WB) (WB Suggested Anti-AIP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)
Related Product Information for anti-AIP antibody
This is a rabbit polyclonal antibody against AIP. It was validated on Western Blot

Target Description: The protein encoded by this gene is a receptor for aryl hydrocarbons and a ligand-activated transcription factor. The encoded protein is found in the cytoplasm as part of a multiprotein complex, but upon binding of ligand is transported to the nucleus. This protein can regulate the expression of many xenobiotic metabolizing enzymes. Also, the encoded protein can bind specifically to and inhibit the activity of hepatitis B virus.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
AH receptor-interacting protein isoform 1
NCBI Official Synonym Full Names
aryl hydrocarbon receptor interacting protein
NCBI Official Symbol
AIP
NCBI Official Synonym Symbols
ARA9; XAP2; PITA1; XAP-2; FKBP16; FKBP37; SMTPHN
NCBI Protein Information
AH receptor-interacting protein
UniProt Protein Name
AH receptor-interacting protein
UniProt Gene Name
AIP
UniProt Synonym Gene Names
XAP2; AIP; XAP-2
UniProt Entry Name
AIP_HUMAN

NCBI Description

The protein encoded by this gene is a receptor for aryl hydrocarbons and a ligand-activated transcription factor. The encoded protein is found in the cytoplasm as part of a multiprotein complex, but upon binding of ligand is transported to the nucleus. This protein can regulate the expression of many xenobiotic metabolizing enzymes. Also, the encoded protein can bind specifically to and inhibit the activity of hepatitis B virus. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014]

Uniprot Description

AIP: May play a positive role in AHR-mediated (aromatic hydrocarbon receptor) signaling, possibly by influencing its receptivity for ligand and/or its nuclear targeting. Defects in AIP are a cause of growth hormone-secreting pituitary adenoma (GHSPA); also known as familial isolated somatotropinomas (FIS) or isolated familial somatotropinoma (IFS) or familial somatotrophinoma or acromegaly due to pituitary adenoma. Defects in AIP are a cause of ACTH-secreting pituitary adenoma (ASPA); also known as pituitary Cushing disease. A pituary adenoma resulting in excessive production of adrenocorticotropic hormone. This leads to hypersecretion of cortisol by the adrenal glands and ACTH-dependent Cushing syndrome. Clinical manifestations of Cushing syndrome include facial and trunkal obesity, abdominal striae, muscular weakness, osteoporosis, arterial hypertension, diabetes. Defects in AIP are a cause of prolactin-secreting pituitary adenoma (PSPA); also known as prolactinoma. Prolactin-secreting pituitary adenoma is the most common type of hormonally active pituitary adenoma.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 11q13.3

Cellular Component: nucleoplasm; cytoplasm; plasma membrane; cytosol

Molecular Function: protein binding; signal transducer activity; transcription coactivator activity; unfolded protein binding; transcription factor binding

Biological Process: protein maturation via protein folding; xenobiotic metabolic process; signal transduction; negative regulation of cyclic-nucleotide phosphodiesterase activity; protein targeting to mitochondrion

Disease: Pituitary Adenoma, Prolactin-secreting; Pituitary Adenoma, Acth-secreting; Pituitary Adenoma, Growth Hormone-secreting

Research Articles on AIP

Similar Products

Product Notes

The AIP aip (Catalog #AAA3213757) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AIP antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AIP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AIP aip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NAQEAQADFA KVLELDPALA PVVSRELQAL EARIRQKDEE DKARFRGIFS. It is sometimes possible for the material contained within the vial of "AIP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.