Rabbit anti-Human AIFM1 Polyclonal Antibody | anti-AIFM1 antibody

AIFM1 (Programmed Cell Death Protein 8, Apoptosis-inducing Factor 1, Mitochondrial, AIF, PDCD8) (AP)

Cat. Num. AAA6369154

• Gene Names: AIFM1; AIF; CMT2D; CMTX4; COWCK; DFNX5; NADMR; NAMSD; PDCD8; COXPD6
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AIFM1; Polyclonal Antibody; AIFM1 (Programmed Cell Death Protein 8; Apoptosis-inducing Factor 1; Mitochondrial; AIF; PDCD8) (AP); anti-AIFM1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human AIFM1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-AIFM1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human AIFM1, aa1-613 (NP_004199.1).
• Immunogen Sequence: MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGASGGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(AIFM1 rabbit polyclonal antibody. Western Blot analysis of AIFM1 expression in human liver.)

Western Blot (WB)

(AIFM1 rabbit polyclonal antibody. Western Blot analysis of AIFM1 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of AIFM1 expression in transfected 293T cell line by AIFM1 polyclonal antibody. Lane 1: AIFM1 transfected lysate (66.9kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-AIFM1 antibody

Apoptosis is characterized by several morphological nuclear changes, such as chromatin condensation and nuclear fragmentation. These changes are triggered by the activation of members of the caspase family, caspase activated DNase, and several novel proteins. A novel gene, the product of which causes chromatin condensation and DNA fragmentation, was recently identified, cloned, and designated apoptosis inducing factor (AIF). Like the critical molecules, cytochrome C and caspase-9, in apoptosis, AIF localizes in mitochondria. AIF translocates to the nucleus when apoptosis is induced and induces mitochondria to release the apoptogenic proteins cytochrome C and caspase-9. AIF induces chromatin condensation and large-scale DNA fragmentation, which are the hallmarks of apoptosis, of the isolated nucleus and the nucleus in live cells by microinjection and apoptosis stimuli.

Product Categories/Family for anti-AIFM1 antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 4757732
• NCBI GeneID: 9131
• NCBI Accession #: NP_004199.1
• NCBI GenBank Nucleotide #: NM_004208
• UniProt Accession #: O95831; Q1L6K4; Q1L6K6; Q2QKE4; Q5JUZ7; Q6I9X6; Q9Y3I3; Q9Y3I4; A4QPB4; B1ALN1; B2RB08; D3DTE9
• Molecular Weight: 26,033 Da
• NCBI Official Full Name: apoptosis-inducing factor 1, mitochondrial isoform AIF
• NCBI Official Synonym Full Names: apoptosis inducing factor mitochondria associated 1
• NCBI Official Symbol: AIFM1
• NCBI Official Synonym Symbols: AIF; CMT2D; CMTX4; COWCK; DFNX5; NADMR; NAMSD; PDCD8; COXPD6
• NCBI Protein Information: apoptosis-inducing factor 1, mitochondrial
• UniProt Protein Name: Apoptosis-inducing factor 1, mitochondrial
• UniProt Gene Name: AIFM1
• UniProt Synonym Gene Names: AIF; PDCD8
• UniProt Entry Name: AIFM1_HUMAN

NCBI Description

This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6 (COXPD6), a severe mitochondrial encephalomyopathy, as well as Cowchock syndrome, also known as X-linked recessive Charcot-Marie-Tooth disease-4 (CMTX-4), a disorder resulting in neuropathy, and axonal and motor-sensory defects with deafness and mental retardation. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 10. [provided by RefSeq, Aug 2015]

Uniprot Description

PDCD8: Probable oxidoreductase that has a dual role in controlling cellular life and death; during apoptosis, it is translocated from the mitochondria to the nucleus to function as a proapoptotic factor in a caspase-independent pathway, while in normal mitochondria, it functions as an antiapoptotic factor via its oxidoreductase activity. The soluble form (AIFsol) found in the nucleus induces 'parthanatos' i.e., caspase-independent fragmentation of chromosomal DNA. Interacts with EIF3G,and thereby inhibits the EIF3 machinery and protein synthesis, and activates casapse-7 to amplify apoptosis. Plays a critical role in caspase- independent, pyknotic cell death in hydrogen peroxide-exposed cells. Binds to DNA in a sequence-independent manner. Interacts with XIAP/BIRC4. Interacts (via N-terminus) with EIF3G (via C-terminus). Belongs to the FAD-dependent oxidoreductase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.-.-.-; Mitochondrial; Oxidoreductase; Apoptosis

Chromosomal Location of Human Ortholog: Xq26.1

Cellular Component: mitochondrion; perinuclear region of cytoplasm; mitochondrial inner membrane; mitochondrial intermembrane space; cytosol; nucleus

Molecular Function: protein dimerization activity; protein binding; oxidoreductase activity, acting on NADH or NADPH; electron carrier activity; DNA binding; NAD(P)H oxidase activity

Biological Process: neuron differentiation; chromosome condensation; caspase activation; mitochondrial respiratory chain complex I assembly; neuron apoptosis; cell redox homeostasis; apoptosis; positive regulation of apoptosis; DNA fragmentation during apoptosis; DNA catabolic process

Disease: Cowchock Syndrome