Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (AIFM1 rabbit polyclonal antibody. Western Blot analysis of AIFM1 expression in human liver.)

Rabbit anti-Human AIFM1 Polyclonal Antibody | anti-AIFM1 antibody

AIFM1 (Programmed Cell Death Protein 8, Apoptosis-inducing Factor 1, Mitochondrial, AIF, PDCD8) (AP)

Gene Names
AIFM1; AIF; CMT2D; CMTX4; COWCK; DFNX5; NADMR; NAMSD; PDCD8; COXPD6
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AIFM1; Polyclonal Antibody; AIFM1 (Programmed Cell Death Protein 8; Apoptosis-inducing Factor 1; Mitochondrial; AIF; PDCD8) (AP); anti-AIFM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human AIFM1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-AIFM1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human AIFM1, aa1-613 (NP_004199.1).
Immunogen Sequence
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGASGGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(AIFM1 rabbit polyclonal antibody. Western Blot analysis of AIFM1 expression in human liver.)

Western Blot (WB) (AIFM1 rabbit polyclonal antibody. Western Blot analysis of AIFM1 expression in human liver.)

Western Blot (WB)

(AIFM1 rabbit polyclonal antibody. Western Blot analysis of AIFM1 expression in A-431.)

Western Blot (WB) (AIFM1 rabbit polyclonal antibody. Western Blot analysis of AIFM1 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of AIFM1 expression in transfected 293T cell line by AIFM1 polyclonal antibody. Lane 1: AIFM1 transfected lysate (66.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AIFM1 expression in transfected 293T cell line by AIFM1 polyclonal antibody. Lane 1: AIFM1 transfected lysate (66.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-AIFM1 antibody
Apoptosis is characterized by several morphological nuclear changes, such as chromatin condensation and nuclear fragmentation. These changes are triggered by the activation of members of the caspase family, caspase activated DNase, and several novel proteins. A novel gene, the product of which causes chromatin condensation and DNA fragmentation, was recently identified, cloned, and designated apoptosis inducing factor (AIF). Like the critical molecules, cytochrome C and caspase-9, in apoptosis, AIF localizes in mitochondria. AIF translocates to the nucleus when apoptosis is induced and induces mitochondria to release the apoptogenic proteins cytochrome C and caspase-9. AIF induces chromatin condensation and large-scale DNA fragmentation, which are the hallmarks of apoptosis, of the isolated nucleus and the nucleus in live cells by microinjection and apoptosis stimuli.
Product Categories/Family for anti-AIFM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,033 Da
NCBI Official Full Name
apoptosis-inducing factor 1, mitochondrial isoform AIF
NCBI Official Synonym Full Names
apoptosis inducing factor mitochondria associated 1
NCBI Official Symbol
AIFM1
NCBI Official Synonym Symbols
AIF; CMT2D; CMTX4; COWCK; DFNX5; NADMR; NAMSD; PDCD8; COXPD6
NCBI Protein Information
apoptosis-inducing factor 1, mitochondrial
UniProt Protein Name
Apoptosis-inducing factor 1, mitochondrial
UniProt Gene Name
AIFM1
UniProt Synonym Gene Names
AIF; PDCD8
UniProt Entry Name
AIFM1_HUMAN

NCBI Description

This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6 (COXPD6), a severe mitochondrial encephalomyopathy, as well as Cowchock syndrome, also known as X-linked recessive Charcot-Marie-Tooth disease-4 (CMTX-4), a disorder resulting in neuropathy, and axonal and motor-sensory defects with deafness and mental retardation. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 10. [provided by RefSeq, Aug 2015]

Uniprot Description

PDCD8: Probable oxidoreductase that has a dual role in controlling cellular life and death; during apoptosis, it is translocated from the mitochondria to the nucleus to function as a proapoptotic factor in a caspase-independent pathway, while in normal mitochondria, it functions as an antiapoptotic factor via its oxidoreductase activity. The soluble form (AIFsol) found in the nucleus induces 'parthanatos' i.e., caspase-independent fragmentation of chromosomal DNA. Interacts with EIF3G,and thereby inhibits the EIF3 machinery and protein synthesis, and activates casapse-7 to amplify apoptosis. Plays a critical role in caspase- independent, pyknotic cell death in hydrogen peroxide-exposed cells. Binds to DNA in a sequence-independent manner. Interacts with XIAP/BIRC4. Interacts (via N-terminus) with EIF3G (via C-terminus). Belongs to the FAD-dependent oxidoreductase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.-.-.-; Mitochondrial; Oxidoreductase; Apoptosis

Chromosomal Location of Human Ortholog: Xq26.1

Cellular Component: mitochondrion; perinuclear region of cytoplasm; mitochondrial inner membrane; mitochondrial intermembrane space; cytosol; nucleus

Molecular Function: protein dimerization activity; protein binding; oxidoreductase activity, acting on NADH or NADPH; electron carrier activity; DNA binding; NAD(P)H oxidase activity

Biological Process: neuron differentiation; chromosome condensation; caspase activation; mitochondrial respiratory chain complex I assembly; neuron apoptosis; cell redox homeostasis; apoptosis; positive regulation of apoptosis; DNA fragmentation during apoptosis; DNA catabolic process

Disease: Cowchock Syndrome

Research Articles on AIFM1

Similar Products

Product Notes

The AIFM1 aifm1 (Catalog #AAA6369154) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AIFM1 (Programmed Cell Death Protein 8, Apoptosis-inducing Factor 1, Mitochondrial, AIF, PDCD8) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AIFM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AIFM1 aifm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AIFM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.