Western Blot (WB)
(WB Suggested Anti-AHCYL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)
Rabbit AHCYL1 Polyclonal Antibody | anti-AHCYL1 antibody
AHCYL1 antibody - N-terminal region
Gene Names
AHCYL1; DCAL; IRBIT; PPP1R78; PRO0233; XPVKONA
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AHCYL1; Polyclonal Antibody; AHCYL1 antibody - N-terminal region; anti-AHCYL1 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE
Sequence Length
530
Applicable Applications for anti-AHCYL1 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human AHCYL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-AHCYL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)
Western Blot (WB)
(WB Suggested Anti-AHCYL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)
Related Product Information for anti-AHCYL1 antibody
This is a rabbit polyclonal antibody against AHCYL1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: AHCYL1 belongs to the adenosylhomocysteinase family.The protein, an inositol 1,4,5-trisphosphate receptor-binding protein, specifically binds to and activates pancreas-type Na+/HCO3- cotransporter 1 (pNBC1).The regulation through AHCYL1 enables NBC1 variants to have different physiological roles.
Target Description: AHCYL1 belongs to the adenosylhomocysteinase family.The protein, an inositol 1,4,5-trisphosphate receptor-binding protein, specifically binds to and activates pancreas-type Na+/HCO3- cotransporter 1 (pNBC1).The regulation through AHCYL1 enables NBC1 variants to have different physiological roles.
Product Categories/Family for anti-AHCYL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
S-adenosylhomocysteine hydrolase-like protein 1 isoform a
NCBI Official Synonym Full Names
adenosylhomocysteinase like 1
NCBI Official Symbol
AHCYL1
NCBI Official Synonym Symbols
DCAL; IRBIT; PPP1R78; PRO0233; XPVKONA
NCBI Protein Information
S-adenosylhomocysteine hydrolase-like protein 1
UniProt Protein Name
Putative adenosylhomocysteinase 2
Protein Family
UniProt Gene Name
AHCYL1
UniProt Synonym Gene Names
DCAL; XPVKONA; AdoHcyase 2; IRBIT
UniProt Entry Name
SAHH2_HUMAN
NCBI Description
The protein encoded by this gene interacts with inositol 1,4,5-trisphosphate receptor, type 1 and may be involved in the conversion of S-adenosyl-L-homocysteine to L-homocysteine and adenosine. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2011]
Research Articles on AHCYL1
Similar Products
Product Notes
The AHCYL1 ahcyl1 (Catalog #AAA3201348) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AHCYL1 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AHCYL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AHCYL1 ahcyl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSMPDAMPLP GVGEELKQAK EIEDAEKYSF MATVTKAPKK QIQFADDMQE. It is sometimes possible for the material contained within the vial of "AHCYL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
