Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AGPAT3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

Rabbit AGPAT3 Polyclonal Antibody | anti-AGPAT3 antibody

AGPAT3 antibody - middle region

Gene Names
AGPAT3; LPAAT3; LPAAT-GAMMA1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AGPAT3; Polyclonal Antibody; AGPAT3 antibody - middle region; anti-AGPAT3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAA
Sequence Length
376
Applicable Applications for anti-AGPAT3 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AGPAT3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AGPAT3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

Western Blot (WB) (WB Suggested Anti-AGPAT3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Related Product Information for anti-AGPAT3 antibody
This is a rabbit polyclonal antibody against AGPAT3. It was validated on Western Blot

Target Description: The protein encoded by this gene is an acyltransferase that converts lysophosphatidic acid into phosphatidic acid, which is the second step in the de novo phospholipid biosynthetic pathway. The encoded protein may be an integral membrane protein. Two transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-AGPAT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
1-acyl-sn-glycerol-3-phosphate acyltransferase gamma
NCBI Official Synonym Full Names
1-acylglycerol-3-phosphate O-acyltransferase 3
NCBI Official Symbol
AGPAT3
NCBI Official Synonym Symbols
LPAAT3; LPAAT-GAMMA1
NCBI Protein Information
1-acyl-sn-glycerol-3-phosphate acyltransferase gamma
UniProt Protein Name
1-acyl-sn-glycerol-3-phosphate acyltransferase gamma
UniProt Gene Name
AGPAT3
UniProt Synonym Gene Names
LPAAT3; 1-AGP acyltransferase 3; 1-AGPAT 3; LPAAT-gamma
UniProt Entry Name
PLCC_HUMAN

NCBI Description

The protein encoded by this gene is an acyltransferase that converts lysophosphatidic acid into phosphatidic acid, which is the second step in the de novo phospholipid biosynthetic pathway. The encoded protein may be an integral membrane protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

AGPAT3: Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - ether lipid; Membrane protein, multi-pass; Acetyltransferase; Lipid Metabolism - glycerolipid; Lipid Metabolism - glycerophospholipid; Membrane protein, integral; EC 2.3.1.51

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: endoplasmic reticulum membrane; membrane; endoplasmic reticulum; integral to membrane; plasma membrane; nuclear envelope

Molecular Function: 1-acylglycerol-3-phosphate O-acyltransferase activity

Biological Process: phospholipid metabolic process; glycerophospholipid biosynthetic process; phosphatidic acid biosynthetic process; triacylglycerol biosynthetic process; cellular lipid metabolic process; CDP-diacylglycerol biosynthetic process; phospholipid biosynthetic process

Research Articles on AGPAT3

Similar Products

Product Notes

The AGPAT3 agpat3 (Catalog #AAA3214964) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGPAT3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's AGPAT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AGPAT3 agpat3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KRKWEEDRDT VVEGLRRLSD YPEYMWFLLY CEGTRFTETK HRVSMEVAAA. It is sometimes possible for the material contained within the vial of "AGPAT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.