Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Mouse AGO1 Polyclonal Antibody | anti-AGO1 antibody

AGO1 (Argonaute RISC Catalytic Component 1, Q99, EIF2C, EIF2C1, GERP95) (MaxLight 650)

Gene Names
AGO1; Q99; EIF2C; EIF2C1; GERP95
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by affinity chromatography.
Synonyms
AGO1; Polyclonal Antibody; AGO1 (Argonaute RISC Catalytic Component 1; Q99; EIF2C; EIF2C1; GERP95) (MaxLight 650); anti-AGO1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes AGO1. Species Crossreactivity: human, mouse
Purity/Purification
Purified by affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-AGO1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Synthetic peptide corresponding to aa1-180, MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIKPDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGEGKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFF of human AGO1.
Conjugate
MaxLight650
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-AGO1 antibody
This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and argonaute 4.
Product Categories/Family for anti-AGO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97,214 Da
NCBI Official Full Name
protein argonaute-1
NCBI Official Synonym Full Names
argonaute RISC catalytic component 1
NCBI Official Symbol
AGO1
NCBI Official Synonym Symbols
Q99; EIF2C; EIF2C1; GERP95
NCBI Protein Information
protein argonaute-1; hAgo1; eIF2C 1; eIF-2C 1; argonaute1; argonaute 1; putative RNA-binding protein Q99; Golgi Endoplasmic Reticulum protein 95 kDa; eukaryotic translation initiation factor 2C, 1
UniProt Protein Name
Protein argonaute-1
Protein Family
UniProt Gene Name
AGO1
UniProt Synonym Gene Names
EIF2C1; Argonaute1; hAgo1; eIF-2C 1; eIF2C 1
UniProt Entry Name
AGO1_HUMAN

NCBI Description

This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and argonaute 4. [provided by RefSeq, Jul 2008]

Uniprot Description

AGO1: Required for RNA-mediated gene silencing (RNAi). Binds to short RNAs such as microRNAs (miRNAs) or short interfering RNAs (siRNAs), and represses the translation of mRNAs which are complementary to them. Lacks endonuclease activity and does not appear to cleave target mRNAs. Also required for transcriptional gene silencing (TGS) of promoter regions which are complementary to bound short antigene RNAs (agRNAs). Interacts with DDB1, DDX5, DDX6, DHX30, DHX36, DDX47, DICER1, EIF2C2/AGO2, ELAVL1, HNRNPF, IGF2BP1, ILF3, IMP8, MATR3, MOV10, PABPC1, PRMT5, RBM4, SART3, TNRC6B, UPF1 and YBX1. Associates with polysomes and messenger ribonucleoproteins (mNRPs). Interacts with LIMD1, WTIP and AJUBA. Belongs to the argonaute family. Ago subfamily.

Protein type: RNA-binding; Translation

Chromosomal Location of Human Ortholog: 1p34.3

Cellular Component: nucleoplasm; polysome; cytoplasm; cytosol; ribonucleoprotein complex

Molecular Function: endoribonuclease activity; protein binding; miRNA binding; RNA binding

Biological Process: epidermal growth factor receptor signaling pathway; Notch signaling pathway; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; nerve growth factor receptor signaling pathway; transcription, DNA-dependent; miRNA-mediated gene silencing, mRNA cleavage; miRNA-mediated gene silencing, negative regulation of translation; innate immune response; gene expression; positive regulation of transcription from RNA polymerase II promoter; posttranscriptional gene silencing

Research Articles on AGO1

Similar Products

Product Notes

The AGO1 ago1 (Catalog #AAA6405802) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGO1 (Argonaute RISC Catalytic Component 1, Q99, EIF2C, EIF2C1, GERP95) (MaxLight 650) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's AGO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AGO1 ago1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AGO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.