Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of AFF44 expression in COLO320 whole cell lysates (lane 1). AFF44 at 127KD was detected using rabbit anti- AFF44 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Human AFF4 Polyclonal Antibody | anti-AFF4 antibody

Anti-AFF4 Antibody

Gene Names
AFF4; MCEF; CHOPS; AF5Q31
Reactivity
Human
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
AFF4; Polyclonal Antibody; Anti-AFF4 Antibody; AF5Q31; Alf4; CHOPS; HSPC092; Laf4; MCEF; Q9UHB7; AF4/FMR2 family member 4; anti-AFF4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1163
Applicable Applications for anti-AFF4 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human AFF4 (6-53aa RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ), identical to the related mouse sequence.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of AFF44 expression in COLO320 whole cell lysates (lane 1). AFF44 at 127KD was detected using rabbit anti- AFF44 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of AFF44 expression in COLO320 whole cell lysates (lane 1). AFF44 at 127KD was detected using rabbit anti- AFF44 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-AFF4 antibody
Rabbit IgG polyclonal antibody for AF4/FMR2 family member 4(AFF4) detection.
Background: The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.
References
1. Izumi, K., Nakato, R., Zhang, Z., Edmondson, A. C., Noon, S., Dulik, M. C., Rajagopalan, R., Venditti, C. P., Gripp, K., Samanich, J., Zackai, E. H., Deardorff, M. A., and 10 others. Germline gain-of-function mutations in AFF4 cause a developmental syndrome functionally linking the super elongation complex and cohesin. Nature Genet. 47: 338-344, 2015.
2. Taki, T., Kano, H., Taniwaki, M., Sako, M., Yanagisawa, M., Hayashi, Y. AF5q31, a newly identified AF4-related gene, is fused to MLL in infant acute lymphoblastic leukemia with ins(5;11)(q31;q31q23). Proc. Nat. Acad. Sci. 96: 14535-14540, 1999.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,823 Da
NCBI Official Full Name
AF4/FMR2 family member 4
NCBI Official Synonym Full Names
AF4/FMR2 family member 4
NCBI Official Symbol
AFF4
NCBI Official Synonym Symbols
MCEF; CHOPS; AF5Q31
NCBI Protein Information
AF4/FMR2 family member 4
UniProt Protein Name
AF4/FMR2 family member 4
Protein Family
UniProt Gene Name
AFF4
UniProt Synonym Gene Names
AF5Q31; MCEF; Protein AF-5q31

NCBI Description

The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. A chromosomal translocation involving this gene and MLL gene on chromosome 11 is found in infant acute lymphoblastic leukemia with ins(5;11)(q31;q31q23). [provided by RefSeq, Oct 2011]

Uniprot Description

MCEF: a putative transcription factor. Component of the cyclin-dependent kinase pair (CDK9/cyclin-T1) complex, also called positive transcription elongation factor b (P-TEFb). Genetic fusion of its gene with MLL has been observed in a subset of acute lymphoblastic leukemia patients. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Oncoprotein; Transcription factor

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: transcription elongation factor complex

Molecular Function: protein binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter

Disease: Chops Syndrome

Research Articles on AFF4

Similar Products

Product Notes

The AFF4 aff4 (Catalog #AAA178686) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-AFF4 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AFF4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the AFF4 aff4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AFF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.