Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ADRA1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)

Rabbit ADRA1B Polyclonal Antibody | anti-ADRA1B antibody

ADRA1B antibody - C-terminal region

Gene Names
ADRA1B; ADRA1; ALPHA1BAR
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADRA1B; Polyclonal Antibody; ADRA1B antibody - C-terminal region; anti-ADRA1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPP
Sequence Length
520
Applicable Applications for anti-ADRA1B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ADRA1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ADRA1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-ADRA1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)
Related Product Information for anti-ADRA1B antibody
This is a rabbit polyclonal antibody against ADRA1B. It was validated on Western Blot

Target Description: Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of which signal through the Gq/11 family of G-proteins and different subtypes show different patterns of activation. This gene encodes alpha-1B-adrenergic receptor, which induces neoplastic transformation when transfected into NIH 3T3 fibroblasts and other cell lines. Thus, this normal cellular gene is identified as a protooncogene. This gene comprises 2 exons and a single large intron of at least 20 kb that interrupts the coding region.
Product Categories/Family for anti-ADRA1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
147
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
alpha-1B adrenergic receptor
NCBI Official Synonym Full Names
adrenoceptor alpha 1B
NCBI Official Symbol
ADRA1B
NCBI Official Synonym Symbols
ADRA1; ALPHA1BAR
NCBI Protein Information
alpha-1B adrenergic receptor
UniProt Protein Name
Alpha-1B adrenergic receptor
UniProt Gene Name
ADRA1B
UniProt Synonym Gene Names
Alpha-1B adrenoceptor
UniProt Entry Name
ADA1B_HUMAN

NCBI Description

Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of which signal through the Gq/11 family of G-proteins and different subtypes show different patterns of activation. This gene encodes alpha-1B-adrenergic receptor, which induces neoplastic transformation when transfected into NIH 3T3 fibroblasts and other cell lines. Thus, this normal cellular gene is identified as a protooncogene. This gene comprises 2 exons and a single large intron of at least 20 kb that interrupts the coding region. [provided by RefSeq, Jul 2008]

Uniprot Description

ADRA1B: a G protein-coupled catecholamine receptor that activates mitogenic responses and regulates growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of which signal through the Gq/11 family of G-proteins and different subtypes show different patterns of activation. Can induce neoplastic transformation when transfected into cell lines. Can regulate the phosphorylation status of the STAT3 pathway. Mediates blood pressure and aorta contractile responses induced by alpha-1 agonists. Activates a phosphatidylinositol second messenger system.

Protein type: Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1

Chromosomal Location of Human Ortholog: 5q33.3

Cellular Component: nuclear membrane; integral to plasma membrane; plasma membrane; nucleus

Molecular Function: protein heterodimerization activity; alpha1-adrenergic receptor activity

Biological Process: adult heart development; vasoconstriction of artery involved in baroreceptor response to lowering of systemic arterial blood pressure; positive regulation of the force of heart contraction by epinephrine-norepinephrine; multicellular organismal development; response to amphetamine; response to morphine; locomotory behavior; glucose homeostasis; positive regulation of glycogen catabolic process; G-protein signaling, coupled to cAMP nucleotide second messenger; cell proliferation; G-protein coupled receptor protein signaling pathway; organ growth; positive regulation of MAPKKK cascade; cell-cell signaling; behavioral response to cocaine; regulation of vasoconstriction; visual learning; blood vessel remodeling; cell growth; positive regulation of heart rate by epinephrine-norepinephrine; negative regulation of glycogen catabolic process

Research Articles on ADRA1B

Similar Products

Product Notes

The ADRA1B adra1b (Catalog #AAA3214592) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADRA1B antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADRA1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADRA1B adra1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YRPWTRGGSL ERSQSRKDSL DDSGSCLSGS QRTLPSASPS PGYLGRGAPP. It is sometimes possible for the material contained within the vial of "ADRA1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.