Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ADORA2B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)

Rabbit ADORA2B Polyclonal Antibody | anti-ADORA2B antibody

ADORA2B antibody - C-terminal region

Gene Names
ADORA2B; ADORA2
Reactivity
Dog, Guinea Pig, Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADORA2B; Polyclonal Antibody; ADORA2B antibody - C-terminal region; anti-ADORA2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHAN
Sequence Length
332
Applicable Applications for anti-ADORA2B antibody
Western Blot (WB)
Homology
Dog: 79%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ADORA2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ADORA2B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-ADORA2B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)
Related Product Information for anti-ADORA2B antibody
This is a rabbit polyclonal antibody against ADORA2B. It was validated on Western Blot

Target Description: This gene encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine. This protein also interacts with netrin-1, which is involved in axon elongation. The gene is located near the Smith-Magenis syndrome region on chromosome 17.
Product Categories/Family for anti-ADORA2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
136
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
adenosine receptor A2b
NCBI Official Synonym Full Names
adenosine A2b receptor
NCBI Official Symbol
ADORA2B
NCBI Official Synonym Symbols
ADORA2
NCBI Protein Information
adenosine receptor A2b
UniProt Protein Name
Adenosine receptor A2b
Protein Family
UniProt Gene Name
ADORA2B
UniProt Entry Name
AA2BR_HUMAN

NCBI Description

This gene encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine. This protein also interacts with netrin-1, which is involved in axon elongation. The gene is located near the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]

Uniprot Description

ADORA2B: Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; Membrane protein, integral; GPCR, family 1

Chromosomal Location of Human Ortholog: 17p12

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: adenosine receptor activity, G-protein coupled

Biological Process: relaxation of vascular smooth muscle; activation of MAPK activity; adenylate cyclase activation; positive regulation of interleukin-6 production; positive regulation of mast cell degranulation; positive regulation of guanylate cyclase activity; excretion; G-protein signaling, adenylate cyclase activating pathway; positive regulation of chemokine production; G-protein coupled receptor protein signaling pathway; positive regulation of chronic inflammatory response to non-antigenic stimulus; cellular response to extracellular stimulus; cellular defense response; JNK cascade; adenosine receptor signaling pathway

Research Articles on ADORA2B

Similar Products

Product Notes

The ADORA2B adora2b (Catalog #AAA3214588) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADORA2B antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ADORA2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADORA2B adora2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKSLAMIVGI FALCWLPVHA VNCVTLFQPA QGKNKPKWAM NMAILLSHAN. It is sometimes possible for the material contained within the vial of "ADORA2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.