Rabbit ADIPOR1 Polyclonal Antibody | anti-ADIPOR1 antibody

ADIPOR1 antibody - N-terminal region

Cat. Num. AAA3215975

• Gene Names: ADIPOR1; CGI45; PAQR1; ACDCR1; CGI-45; TESBP1A
• Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: ADIPOR1; Polyclonal Antibody; ADIPOR1 antibody - N-terminal region; anti-ADIPOR1 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: KGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYK
• Sequence Length: 375

• Applicable Applications for anti-ADIPOR1 antibody: Western Blot (WB)
• Homology: Cow: 85%; Dog: 100%; Goat: 85%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 92%; Rat: 92%
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ADIPOR1Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ADIPOR1Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Related Product Information for anti-ADIPOR1 antibody

This is a rabbit polyclonal antibody against ADIPOR1. It was validated on Western Blot

Target Description: The adiponectin receptors, ADIPOR1 and ADIPOR2, serve as receptors for globular and full-length adiponectin and mediate increased AMPK and PPAR-alpha ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin.

Product Categories/Family for anti-ADIPOR1 antibody

Polyclonal; Signaling Intermediate; Drugs and Drug Metabolism

NCBI and Uniprot Product Information

• NCBI GI #: 21361519
• NCBI GeneID: 51094
• NCBI Accession #: NP_057083
• NCBI GenBank Nucleotide #: NM_015999
• UniProt Accession #: Q96A54
• Molecular Weight: 41kDa
• NCBI Official Full Name: adiponectin receptor protein 1
• NCBI Official Synonym Full Names: adiponectin receptor 1
• NCBI Official Symbol: ADIPOR1
• NCBI Official Synonym Symbols: CGI45; PAQR1; ACDCR1; CGI-45; TESBP1A
• NCBI Protein Information: adiponectin receptor protein 1
• UniProt Protein Name: Adiponectin receptor protein 1
• Protein Family: Adiponectin receptor protein
• UniProt Gene Name: ADIPOR1
• UniProt Synonym Gene Names: PAQR1; TESBP1A
• UniProt Entry Name: ADR1_HUMAN

NCBI Description

This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014]

Uniprot Description

ADIPOR1: Receptor for globular and full-length adiponectin (APM1), an essential hormone secreted by adipocytes that acts as an antidiabetic. Probably involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation. Mediates increased AMPK, PPARA ligand activity, fatty acid oxidation and glucose uptake by adiponectin. Has some high-affinity receptor for globular adiponectin but low-affinity receptor for full-length adiponectin. Belongs to the ADIPOR family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: membrane; plasma membrane; integral to membrane

Molecular Function: adiponectin binding; identical protein binding; hormone binding; protein heterodimerization activity; receptor activity; protein kinase binding

Biological Process: hormone-mediated signaling; adiponectin-mediated signaling pathway; positive regulation of JAK-STAT cascade; fatty acid oxidation; negative regulation of cell growth; positive regulation of insulin receptor signaling pathway; leptin-mediated signaling pathway