Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: EMR2Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ADGRE2 Polyclonal Antibody | anti-ADGRE2 antibody

ADGRE2 Antibody - middle region

Gene Names
ADGRE2; VBU; CD97; EMR2; CD312
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ADGRE2; Polyclonal Antibody; ADGRE2 Antibody - middle region; anti-ADGRE2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VTLRQNQAVMQLDWNQAQKSGDPGPSVVGLVSIPGMGKLLAEAPLVLEPE
Sequence Length
876
Applicable Applications for anti-ADGRE2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EMR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EMR2Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EMR2Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ADGRE2 antibody
This gene encodes a member of the class B seven-span transmembrane (TM7) subfamily of G-protein coupled receptors. These proteins are characterized by an extended extracellular region with a variable number of N-terminal epidermal growth factor-like domains coupled to a TM7 domain via a mucin-like spacer domain. The encoded protein is expressed mainly in myeloid cells where it promotes cell-cell adhesion through interaction with chondroitin sulfate chains. This gene is situated in a cluster of related genes on chromosome 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for anti-ADGRE2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90 kDa
NCBI Official Full Name
adhesion G protein-coupled receptor E2 isoform h
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor E2
NCBI Official Symbol
ADGRE2
NCBI Official Synonym Symbols
VBU; CD97; EMR2; CD312
NCBI Protein Information
adhesion G protein-coupled receptor E2
UniProt Protein Name
EGF-like module-containing mucin-like hormone receptor-like 2
UniProt Gene Name
EMR2
UniProt Entry Name
EMR2_HUMAN

NCBI Description

This gene encodes a member of the class B seven-span transmembrane (TM7) subfamily of G-protein coupled receptors. These proteins are characterized by an extended extracellular region with a variable number of N-terminal epidermal growth factor-like domains coupled to a TM7 domain via a mucin-like spacer domain. The encoded protein is expressed mainly in myeloid cells where it promotes cell-cell adhesion through interaction with chondroitin sulfate chains. This gene is situated in a cluster of related genes on chromosome 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012]

Uniprot Description

EMR2: Cell surface receptor that binds to the chondroitin sulfate moiety of glycosaminoglycan chains and promotes cell attachment. Promotes granulocyte chemotaxis, degranulation and adhesion. In macrophages, promotes the release of inflammatory cytokines, including IL8 and TNF. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, GPCR; GPCR, family 2; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 19p13.1

Cellular Component: integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; calcium ion binding

Biological Process: G-protein coupled receptor protein signaling pathway; cell migration; cell adhesion; inflammatory response

Research Articles on ADGRE2

Similar Products

Product Notes

The ADGRE2 emr2 (Catalog #AAA3220650) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADGRE2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADGRE2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADGRE2 emr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VTLRQNQAVM QLDWNQAQKS GDPGPSVVGL VSIPGMGKLL AEAPLVLEPE. It is sometimes possible for the material contained within the vial of "ADGRE2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.