Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-ADAR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit anti-Human ADAR Polyclonal Antibody | anti-ADAR antibody

ADAR antibody - N-terminal region

Gene Names
ADAR; DSH; AGS6; G1P1; IFI4; P136; ADAR1; DRADA; DSRAD; IFI-4; K88DSRBP
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ADAR; Polyclonal Antibody; ADAR antibody - N-terminal region; anti-ADAR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVS
Sequence Length
1226
Applicable Applications for anti-ADAR antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ADAR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-ADAR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-ADAR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-ADAR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-ADAR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Related Product Information for anti-ADAR antibody
This is a rabbit polyclonal antibody against ADAR. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ADAR is responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.This gene encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product Categories/Family for anti-ADAR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
103
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
136kDa
NCBI Official Full Name
double-stranded RNA-specific adenosine deaminase isoform a
NCBI Official Synonym Full Names
adenosine deaminase RNA specific
NCBI Official Symbol
ADAR
NCBI Official Synonym Symbols
DSH; AGS6; G1P1; IFI4; P136; ADAR1; DRADA; DSRAD; IFI-4; K88DSRBP
NCBI Protein Information
double-stranded RNA-specific adenosine deaminase
UniProt Protein Name
Double-stranded RNA-specific adenosine deaminase
UniProt Gene Name
ADAR
UniProt Synonym Gene Names
ADAR1; DSRAD; G1P1; IFI4; DRADA; p136; IFI-4
UniProt Entry Name
DSRAD_HUMAN

NCBI Description

This gene encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double-stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2010]

Uniprot Description

ADAR: Converts multiple adenosines to inosines and creates I/U mismatched base pairs in double-helical RNA substrates without apparent sequence specificity. Has been found to modify more frequently adenosines in AU-rich regions, probably due to the relative ease of melting A/U base pairs as compared to G/C pairs. Functions to modify viral RNA genomes and may be responsible for hypermutation of certain negative-stranded viruses. Edits the messenger RNAs for glutamate receptor (GLUR) subunits by site- selective adenosine deamination. Produces low-level editing at the GLUR-B Q/R site, but edits efficiently at the R/G site and HOTSPOT1. Binds to short interfering RNAs (siRNA) without editing them and suppresses siRNA-mediated RNA interference. Binds to ILF3/NF90 and up-regulates ILF3-mediated gene expression. Isoform 1 is induced by interferon alpha. Isoform 5 is constitutively expressed. Homodimer. Isoform 1 interacts with ILF2/NF45 and ILF3/NF90. 5 isoforms of the human protein are produced by alternative promoter.

Protein type: RNA-binding; RNA processing; Nucleolus; Hydrolase; EC 3.5.4.37

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: nucleoplasm; membrane; cytoplasm; nucleolus; nucleus

Molecular Function: double-stranded RNA adenosine deaminase activity; protein binding; DNA binding; metal ion binding

Biological Process: positive regulation of viral genome replication; base conversion or substitution editing; in utero embryonic development; response to virus; cytokine and chemokine mediated signaling pathway; miRNA-mediated gene silencing, miRNA loading onto RISC; somatic diversification of immune receptors via somatic mutation; adenosine to inosine editing; osteoblast differentiation; negative regulation of viral genome replication; protein import into nucleus; pre-microRNA processing; mRNA modification; innate immune response; erythrocyte differentiation; gene expression; hemopoietic progenitor cell differentiation; protein export from nucleus; mRNA processing; defense response to virus; negative regulation of apoptosis

Disease: Dyschromatosis Symmetrica Hereditaria; Aicardi-goutieres Syndrome 6

Research Articles on ADAR

Similar Products

Product Notes

The ADAR adar (Catalog #AAA3203283) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADAR antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADAR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the ADAR adar for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GEGKATTAHD LSGKLGTPKK EINRVLYSLA KKGKLQKEAG TPPLWKIAVS. It is sometimes possible for the material contained within the vial of "ADAR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.