Western Blot (WB)
(Host: RabbitTarget Name: ADAM8Sample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse ADAM8 Polyclonal Antibody | anti-ADAM8 antibody
ADAM8 Antibody - N-terminal region
Gene Names
Adam8; MS2; CD156; ADAM 8; CD156a; E430039A18Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
ADAM8; Polyclonal Antibody; ADAM8 Antibody - N-terminal region; anti-ADAM8 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GQYPESLSYALGTSGHVFTLHLRKNRDLLGSSYTETYSAANGSEVTEQLQ
Sequence Length
826
Applicable Applications for anti-ADAM8 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse ADAM8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ADAM8Sample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ADAM8Sample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ADAM8 antibody
This gene encodes a member of the Adam family of proteins that contain the disintegrin and metalloprotease domains. The encoded protein is localized to the cell surface, where it is involved in the remodeling of extracellular matrix and cell migration. Mice lacking the encoded protein display persistent inflammation upon treatment with allergens. Alternative splicing of this gene results in multiple variants.
Product Categories/Family for anti-ADAM8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90 kDa
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 8 isoform 1
NCBI Official Synonym Full Names
a disintegrin and metallopeptidase domain 8
NCBI Official Symbol
Adam8
NCBI Official Synonym Symbols
MS2; CD156; ADAM 8; CD156a; E430039A18Rik
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 8
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 8
Protein Family
UniProt Gene Name
Adam8
UniProt Synonym Gene Names
Ms2; ADAM 8
NCBI Description
This gene encodes a member of the Adam family of proteins that contain the disintegrin and metalloprotease domains. The encoded protein is localized to the cell surface, where it is involved in the remodeling of extracellular matrix and cell migration. Mice lacking the encoded protein display persistent inflammation upon treatment with allergens. Alternative splicing of this gene results in multiple variants. [provided by RefSeq, Mar 2015]
Uniprot Description
Possible involvement in extravasation of leukocytes.
Research Articles on ADAM8
Similar Products
Product Notes
The ADAM8 adam8 (Catalog #AAA3223717) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADAM8 Antibody - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ADAM8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADAM8 adam8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQYPESLSYA LGTSGHVFTL HLRKNRDLLG SSYTETYSAA NGSEVTEQLQ. It is sometimes possible for the material contained within the vial of "ADAM8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
