Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human ACYP1 Polyclonal Antibody | anti-ACYP1 antibody

ACYP1 Polyclonal Antibody

Gene Names
ACYP1; ACYPE
Reactivity
Human
Applications
Immunofluorescence
Purity
Affinity Purification
Synonyms
ACYP1; Polyclonal Antibody; ACYP1 Polyclonal Antibody; ACYPE; anti-ACYP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
Sequence Length
99
Applicable Applications for anti-ACYP1 antibody
Immunofluorescence (IF)
Application Notes
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human ACYP1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-ACYP1 antibody
This gene is a member of the acylphosphatase family. The encoded protein is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated and described based on their tissue localization: erythrocyte (common) type acylphosphatase encoded by this gene, and muscle type acylphosphatase. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-ACYP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
97
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
6kDa/11kDa
NCBI Official Full Name
acylphosphatase-1 isoform a
NCBI Official Synonym Full Names
acylphosphatase 1
NCBI Official Symbol
ACYP1
NCBI Official Synonym Symbols
ACYPE
NCBI Protein Information
acylphosphatase-1
UniProt Protein Name
Acylphosphatase-1
Protein Family
UniProt Gene Name
ACYP1
UniProt Synonym Gene Names
ACYPE

NCBI Description

This gene is a member of the acylphosphatase family. The encoded protein is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated and described based on their tissue localization: erythrocyte (common) type acylphosphatase encoded by this gene, and muscle type acylphosphatase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]

Uniprot Description

Its physiological role is not yet clear.

Research Articles on ACYP1

Similar Products

Product Notes

The ACYP1 acyp1 (Catalog #AAA9135007) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACYP1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACYP1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the ACYP1 acyp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAEGNTLISV DYEIFGKVQG VFFRKHTQAE GKKLGLVGWV QNTDRGTVQG QLQGPISKVR HMQEWLETRG SPKSHIDKAN FNNEKVILKL DYSDFQIVK. It is sometimes possible for the material contained within the vial of "ACYP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.