Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HCBP1Sample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ACY3 Polyclonal Antibody | anti-ACY3 antibody

ACY3 Antibody - C-terminal region

Gene Names
ACY3; ACY-3; HCBP1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACY3; Polyclonal Antibody; ACY3 Antibody - C-terminal region; anti-ACY3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YPELSCQVFLYQRSGEESYNLDSVAKNGLGLELGPQPQGVLRADIFSRMR
Sequence Length
280
Applicable Applications for anti-ACY3 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human ACY3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HCBP1Sample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HCBP1Sample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ACY3 antibody
This is a rabbit polyclonal antibody against HCBP1. It was validated on Western Blot
Product Categories/Family for anti-ACY3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming)
NCBI Official Synonym Full Names
aminoacylase 3
NCBI Official Symbol
ACY3
NCBI Official Synonym Symbols
ACY-3; HCBP1
NCBI Protein Information
N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming)
UniProt Protein Name
N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming)
UniProt Gene Name
ACY3
UniProt Synonym Gene Names
ASPA2; ACY-3; HCBP1; HCV core-binding protein 1
UniProt Entry Name
ACY3_HUMAN

Uniprot Description

ACY3: Plays an important role in deacetylating mercapturic acids in kidney proximal tubules. Belongs to the AspA/AstE family. Aspartoacylase subfamily.

Protein type: Hydrolase; Amino Acid Metabolism - alanine, aspartate and glutamate; EC 3.5.1.114; Amino Acid Metabolism - histidine

Chromosomal Location of Human Ortholog: 11q13.2

Cellular Component: apical plasma membrane; cytosol

Molecular Function: identical protein binding; metal ion binding; hydrolase activity, acting on ester bonds; aminoacylase activity

Biological Process: viral reproduction; xenobiotic metabolic process

Research Articles on ACY3

Similar Products

Product Notes

The ACY3 acy3 (Catalog #AAA3215682) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACY3 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACY3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACY3 acy3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YPELSCQVFL YQRSGEESYN LDSVAKNGLG LELGPQPQGV LRADIFSRMR. It is sometimes possible for the material contained within the vial of "ACY3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.