Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ATF4 expression in transfected 293T cell line by ATF4 polyclonal antibody. Lane 1: ATF4 transfected lysate (38.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Activating Transcription Factor 4 Polyclonal Antibody | anti-ATF4 antibody

Activating Transcription Factor 4 (ATF 4, ATF4 Protein, Cyclic AMP-dependent Transcription Factor ATF-4, Cyclic AMP-responsive Element Binding Protein 2, CREB2, CREB-2, DNA Binding Protein TAXREB67, Tax-responsive Enhancer Element B67, TAXREB67, TXREB) (F

Gene Names
ATF4; CREB2; TXREB; CREB-2; TAXREB67
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Activating Transcription Factor 4; Polyclonal Antibody; Activating Transcription Factor 4 (ATF 4; ATF4 Protein; Cyclic AMP-dependent Transcription Factor ATF-4; Cyclic AMP-responsive Element Binding Protein 2; CREB2; CREB-2; DNA Binding Protein TAXREB67; Tax-responsive Enhancer Element B67; TAXREB67; TXREB) (F; anti-ATF4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ATF4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-ATF4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ATF4, aa1-351 (NP_001666.2).
Immunogen Sequence
MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ATF4 expression in transfected 293T cell line by ATF4 polyclonal antibody. Lane 1: ATF4 transfected lysate (38.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ATF4 expression in transfected 293T cell line by ATF4 polyclonal antibody. Lane 1: ATF4 transfected lysate (38.6kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between ATF4 and CREBBP HeLa cells were stained with ATF4 rabbit purified polyclonal 1:1200 and CREBBP mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between ATF4 and CREBBP HeLa cells were stained with ATF4 rabbit purified polyclonal 1:1200 and CREBBP mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-ATF4 antibody
This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromsome at q28 in a region containing a large inverted duplication.
Product Categories/Family for anti-ATF4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
468
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
cyclic AMP-dependent transcription factor ATF-4
NCBI Official Synonym Full Names
activating transcription factor 4
NCBI Official Symbol
ATF4
NCBI Official Synonym Symbols
CREB2; TXREB; CREB-2; TAXREB67
NCBI Protein Information
cyclic AMP-dependent transcription factor ATF-4; DNA-binding protein TAXREB67; tax-responsive enhancer element B67; cAMP response element-binding protein 2; cAMP-dependent transcription factor ATF-4; cAMP-responsive element-binding protein 2; cyclic AMP-r
UniProt Protein Name
Cyclic AMP-dependent transcription factor ATF-4
UniProt Gene Name
ATF4
UniProt Synonym Gene Names
CREB2; TXREB; cAMP-dependent transcription factor ATF-4; CREB-2; cAMP-responsive element-binding protein 2; TaxREB67
UniProt Entry Name
ATF4_HUMAN

NCBI Description

This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromosome at q28 in a region containing a large inverted duplication. [provided by RefSeq, Sep 2011]

Uniprot Description

ATF-4: a transcription factor that is a member of the leucine zipper family. Isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). Involved in cisplatin resistance. Other members of the family include AP-1 transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. Two alternatively spliced isoforms have been described.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: nucleoplasm; neuron projection; cytoplasm; microtubule organizing center; nucleus

Molecular Function: protein C-terminus binding; protein binding; leucine zipper domain binding; DNA binding; sequence-specific DNA binding; protein heterodimerization activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; amino acid metabolic process; unfolded protein response; positive regulation of apoptosis; negative regulation of potassium ion transport; positive regulation of transcription, DNA-dependent; gluconeogenesis; positive regulation of transcription from RNA polymerase I promoter; cellular response to glucose starvation; cellular protein metabolic process; unfolded protein response, activation of signaling protein activity; regulation of transcription, DNA-dependent; positive regulation of neuron apoptosis; positive regulation of transcription from RNA polymerase II promoter; circadian regulation of gene expression; gamma-aminobutyric acid signaling pathway

Research Articles on ATF4

Similar Products

Product Notes

The ATF4 atf4 (Catalog #AAA6368695) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Activating Transcription Factor 4 (ATF 4, ATF4 Protein, Cyclic AMP-dependent Transcription Factor ATF-4, Cyclic AMP-responsive Element Binding Protein 2, CREB2, CREB-2, DNA Binding Protein TAXREB67, Tax-responsive Enhancer Element B67, TAXREB67, TXREB) (F reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Activating Transcription Factor 4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATF4 atf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Activating Transcription Factor 4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.