Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit ACTH Polyclonal Antibody | anti-ACTH antibody

ACTH Antibody BIOTIN-Conjugated

Reactivity
Human, Mouse, Rat
Predicted: Chicken, Chimpanzee, Cow, Dog, Goat, Guinea pig, Macaque Monkey, Orangutan, Sheep
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Synonyms
ACTH; Polyclonal Antibody; ACTH Antibody BIOTIN-Conjugated; Alpha Melanocyte Stimulating Hormone; Beta Endorphin; Beta Lipotropin; Beta Melanocyte Stimulating Hormone; Beta-endorphin; CLIP; Corticotropin Like Intermediary Peptide; Met-enkephalin; MSH; NPP; Opiomelanocortin prepropeptide; POC; POMC; Tetracosactide antibody; anti-ACTH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Predicted: Chicken, Chimpanzee, Cow, Dog, Goat, Guinea pig, Macaque Monkey, Orangutan, Sheep
Clonality
Polyclonal
Form/Format
BIOTIN-Conjugated
Concentration
0.63-0.68 ug/ul in antibody stabilization buffer (varies by lot)
Sequence Length
268
Applicable Applications for anti-ACTH antibody
ELISA (EIA), Immunohistochemistry (IHC) Formalin/Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Confocal Microscopy||1:250
Immunocytochemistry: 1:250
Immunofluorescence: 1:200
Immunohistochemistry: 1:250
Immunoprecipitation: 1:200
Western Blot: 1:1,000
Immunogen
Synthetic peptide corresponding to ACTH aa 138-176.
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Expression
ACTH and MSH are produced by the pituitary gland
Molecular Function
GPCR; Hormone activity
Structure
Belongs to POMC family
Subcellular Location
Secreted
Preparation and Storage
-20 degree C for long term storage
Related Product Information for anti-ACTH antibody
BIOTIN-Conjugated Adrenocorticotropin Hormone Antibody
Stimulates adrenal glands and release cortisol.

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
proopiomelanocortin, partial

Similar Products

Product Notes

The ACTH (Catalog #AAA540945) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACTH Antibody BIOTIN-Conjugated reacts with Human, Mouse, Rat Predicted: Chicken, Chimpanzee, Cow, Dog, Goat, Guinea pig, Macaque Monkey, Orangutan, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ACTH can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Formalin/Paraffin, Immunoprecipitation (IP), Western Blot (WB). Confocal Microscopy||1:250 Immunocytochemistry: 1:250 Immunofluorescence: 1:200 Immunohistochemistry: 1:250 Immunoprecipitation: 1:200 Western Blot: 1:1,000. Researchers should empirically determine the suitability of the ACTH for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACTH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.