Western Blot (WB)
(Host: RabbitTarget Name: ACTBL2Sample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)
Rabbit ACTBL2 Polyclonal Antibody | anti-ACTBL2 antibody
ACTBL2 Antibody - C-terminal region
Gene Names
ACTBL2; ACT
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACTBL2; Polyclonal Antibody; ACTBL2 Antibody - C-terminal region; anti-ACTBL2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPPIVHRK
Sequence Length
376
Applicable Applications for anti-ACTBL2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ACTBL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ACTBL2Sample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ACTBL2Sample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ACTBL2 antibody
This is a rabbit polyclonal antibody against ACTBL2. It was validated on Western Blot
Target Description: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
Target Description: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
Product Categories/Family for anti-ACTBL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
beta-actin-like protein 2
NCBI Official Synonym Full Names
actin beta like 2
NCBI Official Symbol
ACTBL2
NCBI Official Synonym Symbols
ACT
NCBI Protein Information
beta-actin-like protein 2
UniProt Protein Name
Beta-actin-like protein 2
Protein Family
UniProt Gene Name
ACTBL2
UniProt Entry Name
ACTBL_HUMAN
Uniprot Description
ACTBL2: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to 4 others. Interacts with PFN1 and PFDN1. Belongs to the actin family.
Protein type: Motility/polarity/chemotaxis; Cytoskeletal
Chromosomal Location of Human Ortholog: 5q11.2
Cellular Component: extracellular space; cytoskeleton; cytoplasm
Molecular Function: ATP binding
Research Articles on ACTBL2
1. identified a novel protein, ACTBL2, which was demonstrated to be upregulated in colorectal cancer
Similar Products
Product Notes
The ACTBL2 actbl2 (Catalog #AAA3218258) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACTBL2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ACTBL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACTBL2 actbl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TMKIKIIAPP ERKYSVWIGG SILASLSTFQ QMWISKQEYD EAGPPIVHRK. It is sometimes possible for the material contained within the vial of "ACTBL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
