Western Blot (WB)
(Host: RabbitTarget Name: Acsl4Sample Type: Mouse Thymus lysatesAntibody Dilution: 1.0ug/ml)
Rabbit Acsl4 Polyclonal Antibody | anti-ACSL4 antibody
Acsl4 Antibody - C-terminal region
Gene Names
Acsl4; ACS4; Facl4; Lacs4; AU018108; 9430020A05Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Acsl4; Polyclonal Antibody; Acsl4 Antibody - C-terminal region; anti-ACSL4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYLKDIERMYGG
Sequence Length
711
Applicable Applications for anti-ACSL4 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Acsl4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: Acsl4Sample Type: Mouse Thymus lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: Acsl4Sample Type: Mouse Thymus lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ACSL4 antibody
This is a rabbit polyclonal antibody against Acsl4. It was validated on Western Blot
Target Description: Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses arachidonate and eicosapentaenoate as substrates.
Target Description: Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses arachidonate and eicosapentaenoate as substrates.
Product Categories/Family for anti-ACSL4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79kDa
NCBI Official Full Name
long-chain-fatty-acid--CoA ligase 4 isoform 1
NCBI Official Synonym Full Names
acyl-CoA synthetase long-chain family member 4
NCBI Official Symbol
Acsl4
NCBI Official Synonym Symbols
ACS4; Facl4; Lacs4; AU018108; 9430020A05Rik
NCBI Protein Information
long-chain-fatty-acid--CoA ligase 4
UniProt Protein Name
Long-chain-fatty-acid--CoA ligase 4
UniProt Gene Name
Acsl4
UniProt Synonym Gene Names
Acs4; Facl4; LACS 4; mACS4
UniProt Entry Name
ACSL4_MOUSE
Research Articles on ACSL4
Similar Products
Product Notes
The ACSL4 acsl4 (Catalog #AAA3209624) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Acsl4 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Acsl4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACSL4 acsl4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KLERFEIPIK VRLSPEPWTP ETGLVTDAFK LKRKELKNHY LKDIERMYGG. It is sometimes possible for the material contained within the vial of "Acsl4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
