Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-ACPP antibodyFormalin Fixed Paraffin Embedded Tissue: Human ProstatePrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Rabbit ACPP Polyclonal Antibody | anti-ACPP antibody

ACPP antibody - middle region

Gene Names
ACPP; ACP3; 5'-NT; ACP-3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACPP; Polyclonal Antibody; ACPP antibody - middle region; anti-ACPP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV
Sequence Length
386
Applicable Applications for anti-ACPP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ACPP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-ACPP antibodyFormalin Fixed Paraffin Embedded Tissue: Human ProstatePrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-ACPP antibodyFormalin Fixed Paraffin Embedded Tissue: Human ProstatePrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(WB Suggested Anti-ACPP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)

Western Blot (WB) (WB Suggested Anti-ACPP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)
Related Product Information for anti-ACPP antibody
This is a rabbit polyclonal antibody against ACPP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland. An alternatively spliced trans

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
55
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
prostatic acid phosphatase isoform PAP
NCBI Official Synonym Full Names
acid phosphatase, prostate
NCBI Official Symbol
ACPP
NCBI Official Synonym Symbols
ACP3; 5'-NT; ACP-3
NCBI Protein Information
prostatic acid phosphatase
UniProt Protein Name
Prostatic acid phosphatase
Protein Family
UniProt Gene Name
ACPP
UniProt Synonym Gene Names
PAP; 5'-NT; TMPase
UniProt Entry Name
PPAP_HUMAN

NCBI Description

This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland. An alternatively spliced transcript variant encoding a longer isoform has been found for this gene. This isoform contains a transmembrane domain and is localized in the plasma membrane-endosomal-lysosomal pathway. [provided by RefSeq, Sep 2008]

Uniprot Description

ACPP: A non-specific tyrosine phosphatase that dephosphorylates a diverse number of substrates under acidic conditions (pH 4-6) including alkyl, aryl, and acyl orthophosphate monoesters and phosphorylated proteins. Has lipid phosphatase activity and inactivates lysophosphatidic acid in seminal plasma. Belongs to the histidine acid phosphatase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.3.2; Cofactor and Vitamin Metabolism - riboflavin; Phosphatase; EC 3.1.3.5; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3q22.1

Cellular Component: multivesicular body; extracellular space; Golgi cisterna; apical part of cell; lysosomal membrane; plasma membrane; integral to membrane; vesicle membrane; intracellular; nucleus; secretory granule; filopodium

Molecular Function: 5'-nucleotidase activity; choline binding; identical protein binding; acid phosphatase activity; protein homodimerization activity; phosphoric monoester hydrolase activity; thiamin phosphate phosphatase activity

Biological Process: thiamin metabolic process; dephosphorylation; positive regulation of adenosine receptor signaling pathway; nucleotide metabolic process; regulation of sensory perception of pain; adenosine metabolic process; purine base metabolic process

Research Articles on ACPP

Similar Products

Product Notes

The ACPP acpp (Catalog #AAA3206107) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACPP antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACPP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACPP acpp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CESVHNFTLP SWATEDTMTK LRELSELSLL SLYGIHKQKE KSRLQGGVLV. It is sometimes possible for the material contained within the vial of "ACPP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.