Rabbit anti-Human ACP1 Polyclonal Antibody | anti-ACP1 antibody

ACP1 (Low Molecular Weight Phosphotyrosine Protein Phosphatase, LMW-PTP, LMW-PTPase, Low Molecular Weight Cytosolic Acid Phosphatase, Red Cell Acid Phosphatase 1, PTPase, Adipocyte Acid Phosphatase) (HRP)

Cat. Num. AAA6368597

• Gene Names: ACP1; HAAP; LMWPTP; LMW-PTP
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ACP1; Polyclonal Antibody; ACP1 (Low Molecular Weight Phosphotyrosine Protein Phosphatase; LMW-PTP; LMW-PTPase; Low Molecular Weight Cytosolic Acid Phosphatase; Red Cell Acid Phosphatase 1; PTPase; Adipocyte Acid Phosphatase) (HRP); anti-ACP1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ACP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
• Sequence Length: 158

• Applicable Applications for anti-ACP1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human ACP1, aa1-158 (NP_009030.1).
• Immunogen Sequence: MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ACP1 expression in transfected 293T cell line by ACP1 polyclonal antibody. Lane 1: ACP1 transfected lysate (18kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ACP1 antibody

Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.

Product Categories/Family for anti-ACP1 antibody

Antibodies; Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 6005988
• NCBI GeneID: 52
• NCBI Accession #: NP_009030.1
• NCBI GenBank Nucleotide #: NM_007099.2
• UniProt Accession #: P24666
• NCBI Official Full Name: low molecular weight phosphotyrosine protein phosphatase isoform b
• NCBI Official Synonym Full Names: acid phosphatase 1
• NCBI Official Symbol: ACP1
• NCBI Official Synonym Symbols: HAAP; LMWPTP; LMW-PTP
• NCBI Protein Information: low molecular weight phosphotyrosine protein phosphatase
• UniProt Protein Name: Low molecular weight phosphotyrosine protein phosphatase
• Protein Family: Adult cuticle protein
• UniProt Gene Name: ACP1
• UniProt Synonym Gene Names: LMW-PTP; LMW-PTPase
• UniProt Entry Name: PPAC_HUMAN

NCBI Description

The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2008]

Uniprot Description

ACP1: a phosphotyrosine protein phosphatase. Functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. Hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. Genetically polymorphic with three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Three transcript variants encoding distinct isoforms have been identified for this gene.

Protein type: Cofactor and Vitamin Metabolism - riboflavin; EC 3.1.3.2; Protein phosphatase, tyrosine (non-receptor); Motility/polarity/chemotaxis; EC 3.1.3.48; Phosphatase (non-protein)

Chromosomal Location of Human Ortholog: 2p25

Cellular Component: internal side of plasma membrane; cytoplasm

Molecular Function: protein binding; acid phosphatase activity; non-membrane spanning protein tyrosine phosphatase activity