Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of Aconitase 2 expression in rat skeletal muscle extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). Aconitase 2 at 85KD was detected using rabbit anti- Aconitase 2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit Aconitase 2 Polyclonal Antibody | anti-ACO2 antibody

Anti-Aconitase 2 Antibody

Gene Names
ACO2; ICRD; OCA8; OPA9; ACONM; HEL-S-284
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
Aconitase 2; Polyclonal Antibody; Anti-Aconitase 2 Antibody; ACO 2; ACO2; aconitase 2; aconitase2; aconitase-2; Aconitate hydratase; ACONM; Citrate hydro lyase; ICRD; Q99798; mitochondrial; anti-ACO2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
780
Applicable Applications for anti-ACO2 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Mouse, Rat
Tested Species:In-house tested species with positive results.
Other applications have not been tested.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Aconitase 2 (561-596aa TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH), identical to the related mouse and rat sequences.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of Aconitase 2 expression in rat skeletal muscle extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). Aconitase 2 at 85KD was detected using rabbit anti- Aconitase 2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of Aconitase 2 expression in rat skeletal muscle extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). Aconitase 2 at 85KD was detected using rabbit anti- Aconitase 2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-ACO2 antibody
Rabbit IgG polyclonal antibody for Aconitate hydratase, mitochondrial (ACO2) detection.
Background: Aconitase 2, mitochondrial is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.
References
1. "Entrez Gene: Aconitase 2, mitochondrial".
2. Geurts van Kessel, A. H. M., Westerveld, A., de Groot, P. G., Meera Khan, P., Hagemeijer, A. Regional localization of the genes coding for human ACO2, ARSA, and NAGA on chromosome 22. Cytogenet. Cell Genet. 28: 169-172, 1980.
3. Mirel, D. B., Marder, K., Graziano, J., Freyer, G., Zhao, Q., Mayeux, R., Wilhelmsen, K. C. Characterization of the human mitochondrial aconitase gene (ACO2). Gene 213: 205-218, 1998.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
50
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85,425 Da
NCBI Official Full Name
aconitate hydratase, mitochondrial
NCBI Official Synonym Full Names
aconitase 2
NCBI Official Symbol
ACO2
NCBI Official Synonym Symbols
ICRD; OCA8; OPA9; ACONM; HEL-S-284
NCBI Protein Information
aconitate hydratase, mitochondrial
UniProt Protein Name
Aconitate hydratase, mitochondrial
Protein Family
UniProt Gene Name
ACO2
UniProt Synonym Gene Names
Aconitase
UniProt Entry Name
ACON_HUMAN

NCBI Description

The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification. [provided by RefSeq, Jul 2008]

Uniprot Description

ACO2: Catalyzes the isomerization of citrate to isocitrate via cis-aconitate. Monomer. Belongs to the aconitase/IPM isomerase family.

Protein type: EC 4.2.1.3; Carbohydrate Metabolism - glyoxylate and dicarboxylate; Lyase; Carbohydrate Metabolism - citrate (TCA) cycle; Mitochondrial

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: mitochondrial matrix; mitochondrion; nucleus

Molecular Function: aconitate hydratase activity; iron ion binding

Biological Process: citrate metabolic process; generation of precursor metabolites and energy; tricarboxylic acid cycle

Disease: Infantile Cerebellar-retinal Degeneration; Optic Atrophy 8

Research Articles on ACO2

Similar Products

Product Notes

The ACO2 aco2 (Catalog #AAA178473) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Aconitase 2 Antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's Aconitase 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Mouse, Rat Tested Species:In-house tested species with positive results. Other applications have not been tested. Researchers should empirically determine the suitability of the ACO2 aco2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Aconitase 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.